SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265271 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265271
Domain Number 1 Region: 579-658
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000991
Family Canonical RBD 0.014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000265271
Domain Number - Region: 257-282
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000222
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265271
Sequence length 1039
Comment RBM27 (Homo_sapiens) RNA binding motif protein 27
Sequence
CDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKETSGFVDKLFESLYTKNYLPP
LEPVKPEPKPLIQEKEEIKEEVFQEPAEEERDGRKKKYPSPQKARSESSEQRTREKKRED
GKWRDYERYYERSELYREKYDWRRGRSKSRSKSRGLSRSRSRSRGRSKDRDPNRNVEHRE
RSKFKSERNDLESSYVPVSAPPPNSSEQYSSGAQSIPSTVTVIAPAHHSENTTESWSNYY
NNHSSSNSFGRNPPPKRRCRDYDERGFCVLGDLCQFDHGNDPLVVDEVALPSMIPFPPPP
PGLPPPPPPGMLMPPMPGPGPGPGPGPGPGPGPGPGPGPGHSMRLPVPQGHGQPPPSVVL
PIPRPPISQSSLINSRDQPGTSAVPNLAPVGARLPPPLPQNLLYTVSERQPMYAREHGAA
ASERLQLGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLVPDTYEPDGYNPEAPSITS
SGRSQYRQFFSRTQTQRPNLIGLTSGDMDANPRAANIVIQTEPPVPVSVNSNITRVVLEP
DSRKRAVSGLEGPLTKKPWLGKQGNNNQSKPGFLRKNQYTNTKLEVKKIPQELNNITKLN
EHFSKFGTIVNIQVAFKGDPEAALIQYLTNEEARKAISSTEAVLNNRFIRVLWHRENNEQ
PALQSPTQLLQQTMSHLPQPHHHLPQHLHPQPALVGQAPPSSVHGGIQKMMNKPQTSGAY
VLNKVPVKHRLGHASANQSDASHLLNQSGGAGEDCQMFSPPGHPKTIYSSSNLKTSSKLC
SGSKSHDVQEVLKKKQEAMKLQQDMRKKRQEVLEKQIECQKMLISKLEKNKNMKPEERAN
IMKTLKEHGEKISQLKDELKTSSTISTPSKVKTKTEAQKELLDTELDLHKRLSSGEDTTE
LRKKLSQLQVEAARLGILPVGRGKTMSSQGRGRGRGRGGRGRGSLNHMVVDHRPKALTVR
EFMEEEKDELLQHFSAANQGSKFKDRRLQISWHKPKVPSISTETEEEEVKEEETETSDLF
LHDDDDEDEDEYESRSWRR
Download sequence
Identical sequences G5C841
HGL_H00000265271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]