SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265651 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265651
Domain Number 1 Region: 270-399
Classification Level Classification E-value
Superfamily ApaG-like 7.19e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 89-255
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 3-71
Classification Level Classification E-value
Superfamily F-box domain 7.85e-17
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  HGL_H00000265651
Domain Number - Region: 408-441
Classification Level Classification E-value
Superfamily ARM repeat 0.0104
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265651
Sequence length 461
Comment FBXO3 (Homo_sapiens) F-box protein 3
Sequence
MTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQ
KNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAV
EAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGL
KYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARDPAAIDMFIIGATFTDWFT
SYVSNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVHPPHYFFTYRI
RIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFS
TTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEE
EEEDEDDDSADMDESDEEEEEERRRRVFDVPIRRRRCSRLL
Download sequence
Identical sequences G5BKJ3
HGL_H00000265651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]