SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265742 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265742
Domain Number 1 Region: 10-199
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-21
Family Ankyrin repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 330-417
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-20
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Domain Number 3 Region: 512-561
Classification Level Classification E-value
Superfamily RING/U-box 6.36e-16
Family RING finger domain, C3HC4 0.0011
Further Details:      
 
Domain Number 4 Region: 404-486
Classification Level Classification E-value
Superfamily RING/U-box 0.00000125
Family RING finger domain, C3HC4 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265742
Sequence length 1089
Comment ANKIB1 (Homo_sapiens) ankyrin repeat and IBR domain containing 1
Sequence
MGNTTTKFRKALINGDENLACQIYENNPQLKESLDPNTSYGEPYQHNTPLHYAARHGMNR
ILGTFLFGRDGNPNKRNVHNETSMHLLCMGPQIMISEGALHPRLARPVEDDFRRADCLQM
ILRWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKACVELLVKHGGDLFAENENKD
TPCDCAEKQHHKDLALNLESQMVFSRDPEAEEIEAEYAALDKREPYEGLRPQDLRRLKDM
LIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPENCCQRSGVQMPTPPPSGYNAW
DTLPSPRTPRTTRSSVTSPDEISLSPGDLETSLCDICMCSISVFEDPVDMPCGHDFCRGC
WESFLNLKIQEGEAHNIFCPAYECFQLVPVDIIESVVSKEMDKRYLQFDIKAFVENNPAI
KWCPTAGCERAVRLTKQGSNTSGTDTLSFPLLRAPAVDCGKGHLFCWECLGEAHEPCDCQ
TWKNWLQKITEMKPEELVGVSEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQCVK
CKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVEEQSKEMTVEAEKKHKRFQELDRFM
HYYTRFKNHEHSYQLEQRLLKTAKEKMEQLSRALKETEGGCPDTTFIEDAVHVLLKTRRI
LKCSYPYGFFLEPKSTKKEIFELMQTDLEMVTEDLAQKVNRPYLRTPRHKIIKAACLVQQ
KRQEFLASVARGVAPADSPEAPRRSFAGGTWDWEYLGFASPEEYAEFQYRRRHRQQRRRG
DVHSLLRNPPDHDEPSESTVDSPEGGSGHRPGTSVVSSASMSVLHSSSLRDYTPASRSEN
QDSLQALSSLDEDDPNILLAIQLSLQESGLAIDEETRDFLSHEASLGAIGTSLPSRLDSI
PRNTDSPRAALSSSELLELGDSLMRLGAESEPFSTDTLSSHPVSEARSDFYPSSGDPDST
SQDPSINDNLLGNIMAWFHDMNPQSIALIPPATTEISVDSHISCVKDGSEGVRDVELELP
EDSVFEDAGVSESRGVQKEENALEENILAGETSFQVSDSGNEAAKENGSDVSSQAPETSS
DWLEQVHLV
Download sequence
Identical sequences G5C9K0
HGL_H00000265742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]