SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265854 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265854
Domain Number 1 Region: 487-583
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 2.88e-32
Family Mitotic arrest deficient-like 1, Mad1 0.0000104
Further Details:      
 
Weak hits

Sequence:  HGL_H00000265854
Domain Number - Region: 340-551
Classification Level Classification E-value
Superfamily Tropomyosin 0.00183
Family Tropomyosin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265854
Sequence length 661
Comment MAD1L1 (Homo_sapiens) MAD1 mitotic arrest deficient-like 1 (yeast)
Sequence
MEDLGENTTVLSTLRSLNNFISQRMEGGSGLDISTSAPSSLQMQYQQSMQLEERAEQIRS
KSYLIQVEREKMQMELSHKRARVELEKAASTSARNYEREVDRNQELLAHIRQLQEREAEA
EEKMREQLERHRLCKQSLDTASQQLREQEDSLATASETISTLKGRVSELQWSLMDQEVQV
KRLASEKQELQEQLDLQHRKWQEANQKIQELQASQEARADQEQKIKDLEQKLCLQEQDAA
VVRSMKSELLRLPRVERELKQLREENTYLREMRDTNGLLTEELEGLQRRLGRQEKIQEAL
IGLELEKERLLAKLQCWETLDQTTGLKLRNPEDLSRFIVELQQRELALKEKNNAITSSAR
VLEKAQQQLQEEVRQISGQLLEERKKRENHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTQAEYSPQLTRRMREAEDMVQKVHAHSSEMEAQLSQALEELGCQKQRADMLEMELKIL
KSQPHSSEPSFPFCREEVDTLRLKVEELEAERNRLEQEKNMLEMQLERCTLQGDYDQSRT
KVLHMSLNPTSLAKQRLREERDRLQEECERLRGLVHALERGGPVPTDLEATAGLPSSKEV
AELRKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDITAESQYRLTSQYAEHKND
C
Download sequence
Identical sequences G5BI86
HGL_H00000265854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]