SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265866-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265866-1
Domain Number 1 Region: 9-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.29e-18
Family Canonical RBD 0.0000304
Further Details:      
 
Domain Number 2 Region: 155-204
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000407
Family Canonical RBD 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265866-1
Sequence length 260
Comment HNRNPH3 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein H3 (2H9)
Sequence
MDWVMKHNGPNDASDGTVRLLGLPFGCSKEEIVQFFQWLEIMPNGITMTMDYQGRSTGET
FVQFASKEIAENALGKHKERIGHRYIEIFRSSRSKIKGFYDPPRRLLGQRLGPYDRPIGG
RGGYYGAGRGSYGGFDDYGGYNSYCYGNDGFGDRMRDGRDGRAKGEADVEFVTHEDPVAA
MSKDKNNMQHRYIELFLNSTPRGGSGMGDSGIGGYGRDGMGNQAGYGSVGRMGMRMVLLM
TWVAMAMVVEGVVATMGKVA
Download sequence
Identical sequences G5B2A5
HGL_H00000265866-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]