SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265866-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265866-2
Domain Number 1 Region: 182-276
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.33e-21
Family Canonical RBD 0.0000212
Further Details:      
 
Domain Number 2 Region: 9-105
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.33e-21
Family Canonical RBD 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265866-2
Sequence length 346
Comment HNRNPH3 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein H3 (2H9)
Sequence
MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEA
FVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGG
RGGYYGAGRGSMYDRMRRGGDGYDGGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHG
YGGAGDASSGFHGGHFVHMRGLPFRATENDIANFFSPLNPIRVHIDIGADGRATGEADVE
FVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGSGMGGYGRDGMDNQGGYGSVG
RMGMGNNYSGGYGTPDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY
Download sequence
Identical sequences A0A024QZK8 A0A096P531 A0A0D9R5E6 A0A1U7U3L4 A0A212CPH0 A0A2I2UDQ5 A0A2J8WR95 A0A2K5IJ65 A0A2K5N439 A0A2K5QZT9 A0A2K6D4L5 A0A2K6GX72 A0A2K6KAH6 A0A2K6PED1 A0A2K6SWQ9 E1BB17 F1P8D3 F2Z5W4 F6Y030 F7BZZ0 F7E3S6 G1RME0 G1SLT8 G5B7Z5 G7PDD0 H0V7P5 H2Q1Z3 I3MHT0 L5M212 L8HUI3 P31942 S7NAE0
ENSECAP00000005312 ENSECAP00000005312 ENSDNOP00000003774 ENSOCUP00000003838 ENSPANP00000020456 ENSGGOP00000018561 ENSP00000265866 ENSNLEP00000014404 ENSP00000265866 10141.ENSCPOP00000005765 9544.ENSMMUP00000012822 9598.ENSPTRP00000004408 9606.ENSP00000265866 9796.ENSECAP00000005312 9823.ENSSSCP00000010914 9913.ENSBTAP00000019039 9986.ENSOCUP00000003838 ENSBTAP00000019039 ENSPTRP00000004408 ENSCAFP00000000476 ENSBTAP00000019039 ENSNLEP00000014404 ENSPTRP00000004408 ENSP00000265866 ENSCJAP00000035596 ENSCPOP00000005765 ENSCPOP00000005765 ENSCAFP00000000476 ENSMMUP00000012822 ENSCJAP00000035559 ENSMMUP00000012822 ENSGGOP00000018561 ENSVPAP00000010994 gi|14141157|ref|NP_036339.1| ENSFCAP00000025147 ENSVPAP00000010994 NP_001230484.1.46622 NP_001253678.1.72884 NP_001309363.1.87134 NP_001309363.1.92137 NP_001309365.1.87134 NP_001309365.1.92137 NP_001309366.1.87134 NP_001309366.1.92137 NP_036339.1.87134 NP_036339.1.92137 XP_002718501.1.1745 XP_003258253.1.23891 XP_003473629.2.53824 XP_003830346.1.60992 XP_003928719.1.74449 XP_003994035.1.62641 XP_003994036.1.62641 XP_004049545.1.27298 XP_004393757.1.74151 XP_004393758.1.74151 XP_004470567.1.11602 XP_004470569.1.11602 XP_004470571.1.11602 XP_004777893.1.14098 XP_004777894.1.14098 XP_004777896.1.14098 XP_004846210.1.39548 XP_004846211.1.39548 XP_005005362.1.53824 XP_005226495.1.76553 XP_005326029.1.77405 XP_005565768.1.63531 XP_005602471.1.31192 XP_005619003.1.84170 XP_005619004.1.84170 XP_005619005.1.84170 XP_005699165.1.57651 XP_005699166.1.57651 XP_005876858.1.60319 XP_005876859.1.60319 XP_005876860.1.60319 XP_005876861.1.60319 XP_005907382.1.15283 XP_005958840.1.78601 XP_006070334.1.26621 XP_006070335.1.26621 XP_006070337.1.26621 XP_006070338.1.26621 XP_006089803.1.53796 XP_006089804.1.53796 XP_006149005.1.99106 XP_006149006.1.99106 XP_006181251.1.101512 XP_006181252.1.101512 XP_006212974.1.17985 XP_006212975.1.17985 XP_006728954.1.47382 XP_006728955.1.47382 XP_006760968.1.95426 XP_006760969.1.95426 XP_006915638.1.64745 XP_006915639.1.64745 XP_006915640.1.64745 XP_006937883.1.62641 XP_006972797.1.50099 XP_007095823.2.5354 XP_007095825.1.5354 XP_007095826.1.5354 XP_007961469.1.81039 XP_007961470.1.81039 XP_008060485.1.4292 XP_008060486.1.4292 XP_008143667.1.99482 XP_008268275.1.1745 XP_008268276.1.1745 XP_008268278.1.1745 XP_008505150.1.77740 XP_008954014.1.60992 XP_008954016.1.60992 XP_009456838.1.37143 XP_009456839.1.37143 XP_010337612.1.74449 XP_010337613.1.74449 XP_010373614.1.97406 XP_010373623.1.97406 XP_010604001.1.5607 XP_010818910.1.76553 XP_010850461.1.44457 XP_010850462.1.44457 XP_010850463.1.44457 XP_010850464.1.44457 XP_010850465.1.44457 XP_010850467.1.44457 XP_010949992.1.22495 XP_010949993.1.22495 XP_010984103.1.51371 XP_010984105.1.51371 XP_011370430.1.92234 XP_011370431.1.92234 XP_011370432.1.92234 XP_011713389.1.29376 XP_011713390.1.29376 XP_011713391.1.29376 XP_011713392.1.29376 XP_011782443.1.43180 XP_011782454.1.43180 XP_011940608.1.92194 XP_011940609.1.92194 XP_011940610.1.92194 XP_011981007.1.54773 XP_011981008.1.54773 XP_011981009.1.54773 XP_012514293.1.63892 XP_012514302.1.63892 XP_012514311.1.63892 XP_012618134.1.48125 XP_012618135.1.48125 XP_012618136.1.48125 XP_012618137.1.48125 XP_013214335.1.77405 XP_014588573.1.31192 XP_014688269.1.49734 XP_014688271.1.49734 XP_014918838.1.86478 XP_014918840.1.86478 XP_014918841.1.86478 XP_014961375.1.54773 XP_015002810.1.72884 XP_015002811.1.72884 XP_015311759.1.63531 XP_015311760.1.63531 XP_015316493.1.76553 XP_015316494.1.76553 XP_015447691.1.64745 XP_015846037.1.50099 XP_016053877.1.3490 XP_016053878.1.3490 XP_016871657.1.92137 XP_017204230.1.1745 XP_017369196.1.71028 XP_017369197.1.71028 XP_017369199.1.71028 XP_017706907.1.44346 XP_017706908.1.44346 XP_017706909.1.44346 XP_017897712.1.57651 XP_018890333.1.27298 XP_018890335.1.27298 XP_019060411.1.5607 XP_019299890.1.44245 XP_019299892.1.44245 XP_019299893.1.44245 XP_020042253.1.5219 XP_020042254.1.5219 XP_020042255.1.5219 XP_020725537.1.74333 XP_020725538.1.74333 XP_020725539.1.74333 XP_020725540.1.74333 XP_020927601.1.46622 XP_020927603.1.46622 XP_020927606.1.46622 XP_021555732.1.83697 XP_021555734.1.83697 XP_521495.3.37143 XP_536369.2.84170 HGL_H00000265866-2 ENSOCUP00000003838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]