SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000265997 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000265997
Domain Number 1 Region: 381-552
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.39e-21
Family Canonical RBD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000265997
Sequence length 640
Comment CPEB3 (Homo_sapiens) cytoplasmic polyadenylation element binding protein 3
Sequence
MQDDLLMDKSKTQPQQQRQQQQQEQQQQPQPQPQPEPSTVEAPSTPLSPETPKPEDSSSV
PALSSAAAPPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPTAPGASLSPSFGSTWST
GTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQHHQPAAAAAAAS
SASSSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVCVGVGVGVPSPLNPISPLKKPFSS
NVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIR
TDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNNAFLDDSHGDQ
ALSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESK
SYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFV
MDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAF
SNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTC
LQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS
Download sequence
Identical sequences G5BV06
HGL_H00000265997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]