SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000266022 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000266022
Domain Number 1 Region: 82-222
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000017
Family Pentapeptide repeats 0.022
Further Details:      
 
Domain Number 2 Region: 421-519
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000394
Family Canonical RBD 0.0068
Further Details:      
 
Domain Number 3 Region: 632-730
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000057
Family Canonical RBD 0.017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000266022
Domain Number - Region: 931-973
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0327
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000266022
Sequence length 1106
Comment RBM6 (Homo_sapiens) RNA binding motif protein 6
Sequence
YSGSQEERFAPGWNRDYPPPPLKSHAQERHSGNFPGRDSLPFDFQGHSGPPFANVEEHSF
SYGARDGPHGDYRGGEGPGHDFRGGDFSSTDFQSRDSSQLDFRGRDIHSGDFRDREGPPM
DYRGGDGTSMDFRGRETPHMNYRDRDTHTVDFRGRDPPSDFRGRGTYDLDFRGRDGSHAD
FRGRDLSDLDFRTRDQSRSDFRNRDVSDLDFRDKDGTQVDFRARGSGTTDLDFRDRDTPH
SDFRGRHRSRTDQDFRGRDMGPCVEFKDREMPPVDPKLLDYLQPSTQDREHSCMNVNKRE
ESKYDHTAERPSFGIQKGEFEHSETREGETQGVAFEHELPSDFQKSQSPIQDQDKSQLSG
AEQQSSDAGLFKQKGDLDFLGQQDTDYRSMEYRDVDHRLPGSQIFGYGQNKTFLEGKTAR
DAQRDLQDQDYRTGPSEEKPSRLIRLSGVPENATKEEILNAFRTANGMPVRELQLKEYNT
GYDYGYVCVEFSLLEDAIGCMEANQGTVMIHDKEITLEYVPNLDFWYCKRCKASTGGHRS
SCSFCKCPKEEAKQELITYPQPQKTSIPASLEKQPSQSSRPAEKESESRKQEEGQEPRLG
HQKKEAERYLPHSRREGLAFRRDREKESWSGEMRQDGESKTIMLKRIYRSTPPEVIVEVL
EPYVHLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQNLDPPFSIDGKMVAVN
LATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIYDSAT
GYYYDPLAGTYYDPNTQQEVYVPQDPGSPEEEEIKEKKPTSQGKSSSKKEMPKRDSKEKK
DRAVTKFQEVASEGTSPPEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEE
EEEEQTAPLQPRTTQPQQREELTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLS
DLHKQNLEIHRKIKQSEQELAYLERREREGRFKERGNDRKEKLQSFDCPERKRIKYSRET
DSDRKPVDKEDINTSSKGGCVQQPTGWRKGAGLGFGHPGLGSSEETEGRMRGPGVGLPGR
TSKRQSNETYRDAVRRVMFARYKELD
Download sequence
Identical sequences G5BZY1
HGL_H00000266022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]