SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000266263 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000266263
Domain Number - Region: 88-116
Classification Level Classification E-value
Superfamily Thiolase-like 0.00576
Family Thiolase-related 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000266263
Sequence length 166
Comment MTFP1 (Homo_sapiens) mitochondrial fission process 1
Sequence
MSEPQLRGAERDLYRDTWVRYLGYANEVGEAFRSLVPRAVVWLSYGVSSSYVLADAIDKG
KKAREVSSPEASRSTRVTVAVVDTFMWQALASVAIPGFTINRICATSLYVLGTATRWPVA
VCKWTTTTLGLLAIPIIIHPIDRSVDFLLDSSLRKLYPSEGKPSSS
Download sequence
Identical sequences G5APU8
XP_004843508.1.39548 HGL_H00000266263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]