SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000266505 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000266505
Domain Number 1 Region: 155-475
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.74e-121
Family Mammalian PLC 0.000000108
Further Details:      
 
Domain Number 2 Region: 3-154
Classification Level Classification E-value
Superfamily EF-hand 5.64e-42
Family EF-hand modules in multidomain proteins 0.0029
Further Details:      
 
Domain Number 3 Region: 494-617
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-28
Family PLC-like (P variant) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000266505
Sequence length 618
Comment PLCZ1 (Homo_sapiens) phospholipase C, zeta 1
Sequence
MLLTWFFSKIQDEFRGGKINVERTYKLLEKLDIQCNYVHVKHIFKDNDRQKQGKITIEEF
RSIYRIIAHREEIVEIFNVYSENRRILFESNLIQFLTQEQYEIETTESIASEIIQKYEPI
DEVKKAHQISLEGFTRYIYSSECLLFKQECTKVYQDMTYPLNDYFISSSHNTYLVSDQLV
GPSDLWGYVSALVKGCRCLEIDCWDGSQAEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
EYPVVLSLENHCSTAQQEVMAGILQTTFGDSLLSDILDDFPDSLPSPEALKFKVLVKNKK
IGTLQETRERIGSDKHETYENLLSRDSQGKETETKKALPVTLFSKKKKIRKLKIALALSD
LVIYTKAEKFRSFQYSRQYQQFNENNSIGETQARKLSKLRVNEFIFHTRKFITRIYPKAT
RADSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPQFLRDIKSKF
NPNDSIKDNDPIAITIRLISGIQLPLSGSSSHKPDTLVIIEVFGVPNDHMKRQTRVIKKN
AFSPRWNETFTFIIQVPELALLRFVVENSGLIAGNEFLGQYTLPVLCMSKGYRRVPLFSR
SGESLEPASLFVYVWYVR
Download sequence
Identical sequences G5C2C1
HGL_H00000266505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]