SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000266679 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000266679
Domain Number 1 Region: 87-191
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000219
Family Canonical RBD 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000266679
Sequence length 556
Comment CPSF6 (Homo_sapiens) microRNA 1279
Sequence
MIPLLWSVGMDMKLEASELCKENLEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTL
PPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFE
NRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQ
SGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTP
PRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGP
PPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPH
VNPAFFPPPTNSGMPTSDSRGPPPTDPYGRAPPYDRGDYGPPGREMDTARTPLSEAEFEE
IMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDC
LHGIESKSYGSGSRRRERSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRD
RDRDRERDREREYRHR
Download sequence
Identical sequences G5BBG5
HGL_H00000266679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]