SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000267197 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000267197
Domain Number 1 Region: 1342-1483
Classification Level Classification E-value
Superfamily SET domain 9.55e-47
Family Histone lysine methyltransferases 0.0028
Further Details:      
 
Domain Number 2 Region: 81-178
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.14e-17
Family Canonical RBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000267197
Sequence length 1486
Comment SETD1B (Homo_sapiens) SET domain containing 1B
Sequence
MENSHPHHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHCTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAISPLVNETLQLSDALKRLKDGSLSAGCGSSS
VTPNSSGTPFSQDTAYSSCRLDTPNSYGQDAYNRRHEHHYVHNSAVAGGAATFRGSSDLP
FGAMGSTGSSSAPPFKVQPQDSATFAHTPPPAQAAPGPGFKSAFSPYQTPPTFRLDPEPC
DSPGTPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDPELQMEGSPISSSS
SQLSPLAPFGANSQPGFRGPSPPTSPPSSTGLEDISPTPLPDSDEDDELGLGLGPRPPPE
PGPPDPSALLGQMPEVALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCP
KPMVVAPGAAAVAAPNPPGVPPPPILPPLPPFPPGLFPVMQVDVSHVLGGQWGGMPMSFQ
MQTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLGNSGPGRGQHWPP
LPKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEW
WDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGA
IRLPSFKVKRKEPPDAATSGDQKRLRPSTSVDEDDEESERERDRDTADVPCELAKRDPKA
VGVRRRPARPLELDSGGEEDEKESSSVSSSSSASSTSGSSTSSPSSSASDKEEGRESTEE
EEEEEEEEEEEEEAEEREAERGPRSQVSSSSSTSPQSEKGDGEDSDEQEESENDEEGDTA
LSEASEKDEGDSDAEETVSTVTSKADAESSSESSESSEFGSSSESSSESSEDEQEMAAEE
EEEEEEEEVVAAVAAVAEEITPPAGAEDAEPSREEATLAPGGPGTKSLVTEEEGDLEAEF
TAPGERTPIQEEPPVPVAAEELVGPKEPPEEPGPNQEANMLISPEPPSNEAEVPLPTSPE
RVPGLRGRDEVTEEYMELAKARGPWRRPPKKRHEDLVAPSASPELSPSQPLFRPRSEFEE
MTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPYILPDKKKRDDGIR
EHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQGMSIPAQPHASTRAGSERRSE
QRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQN
IRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVE
SQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
Download sequence
Identical sequences G5AWN7
HGL_H00000267197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]