SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000268182 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000268182
Domain Number 1 Region: 1074-1201,1233-1439
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.2e-78
Family p120GAP domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 140-304
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-39
Family Calponin-homology domain, CH-domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 1664-1761
Classification Level Classification E-value
Superfamily RGC domain-like 9.94e-33
Family RGC domain 0.00000187
Further Details:      
 
Domain Number 4 Region: 736-939
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000135
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000268182
Sequence length 1761
Comment IQGAP1 (Homo_sapiens) IQ motif containing GTPase activating protein 1
Sequence
MPLLSAEDLTMLQMGNNQPPHPQLHDVFAFGTTWNQVPLRQVLLPLSDELTEVSERSRTT
FQKGKTGEKRCYGKVLAVTMEKSDAVLRHMCLLLGIQILNLPKKVHGGSSAYQPSLEPEA
ATAVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGV
YLAKLGNFFSPKVVSLKKIYDREQTRYRATGLHFRHTDNVIQWLNAMDDIGLPKIFYPET
TDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKIELEKYGIQM
PAFSKIGGILANELSVDEAALHAAVIAINEAIDHRIPADTFTALKNPNAMLVNLEEPLAS
TYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNVNKVNTLSALANVDLAL
DQGSTVALLKALQSPALGLRGLQQQNSDWYLKQLLSDKQQKQQSGQLEPLQKEELQAGVD
AANCAAQQYQRRLAAVAAINAAIQKGVAEKTVLELMNPEAQLPQVYPFAADLYQKELATL
QQQSPEHSLTHPELSVAVEMLSSVALINRALESGDMNTVWKQLSSSVTGLTNIEEENCQR
YLDELMKLKAQAHGENNEFITWNDIQACVDQVNLVVQEEHERILAIGLINEALDEGDAQK
TLQALQIPAAKLEGVLAEVAQHYQDMLIRAKREKAQETQDESAVLWLDEIQGGVWQSNKD
TQEAQRFALGIFAINEAVESSDIGKTLSALRSPDVGLYGVIPECGETYQNDLAEAKKKKL
GAGDNNSKWVKHWVKGGYYYYYNLETQEGGWDEPPDFVQNSMQLSREEIQSSISGVTAAY
NREQLWLANEGLITKLQACCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKEYQ
DRLAYLRAHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDIIKIQAFIRANKARDDYK
TLINAEDPPMLVVRKFVHLLDQSDQDFQEELDLMKMREEVITLIRSNQQLENDLNLMDIK
IGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKALSKEKREKLEAYQHLF
YLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIKS
KVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYK
AWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDNSIRNMRAVTDKFLSAIISSVDKI
PYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQ
LTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQKFRRFFQTACDVPELQ
DKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPT
IESLIGESSGSLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVI
RFQPGETLTEILETPASSEQEAEHQRVMQRRAIRDAKTPDKMKKSTSAKEDNNLSLQEKK
EKIQTGLKKLTELGTVDPKNRYQELINDIARDIRNQRRYRQRRKAELVKLQQTFAALNSK
ATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLE
IEDLQVNQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLF
DRAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences G5B1S6
HGL_H00000268182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]