SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000268655 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000268655
Domain Number 1 Region: 40-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.61e-38
Family SCAN domain 0.00000349
Further Details:      
 
Domain Number 2 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 314-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-17
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000268655
Sequence length 407
Comment ZNF174 (Homo_sapiens) zinc finger protein 174
Sequence
MAAKMEITLSSHNQASSKQERHIITKLEEKREPSPPKNCPDPELCRQSFRQFCYQEVSGP
QEALSRLRQLCRQWLQPELHTKEQIMELLVMEQFLIILPPEIQARVRHRCPVSSKEIVTL
VEDFHRAAKKPKQWVAVCVQGQKVLLEKTGSQLGEQELPDFQPQTKRDLRESSLEESSQE
ESHEQLSPQHWEKSQHLQEPAPKLSGTEAPRIRSDNKENPQQEGAKGAKPCAVPAGRAKG
NGLQSPEARGANMCEPWLPRRQVSPPNSQKPFAHYQRHCRELEYISSPQKGHPLRGLRKN
KGGKRGLSSCLQRLGHQATRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECG
NCFGRQSTLKLHQRIHTGEKPYQCSQCGKSFRQSSNLHQHHRLHHGD
Download sequence
Identical sequences G5B1H6
HGL_H00000268655 XP_004864793.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]