SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000269856 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000269856
Domain Number 1 Region: 5-193
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.13e-45
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 355-401,478-575
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-17
Family Ankyrin repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  HGL_H00000269856
Domain Number - Region: 251-284,330-376
Classification Level Classification E-value
Superfamily TPR-like 0.000133
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000269856
Sequence length 624
Comment FEM1A (Homo_sapiens) fem-1 homolog a (C. elegans)
Sequence
MDLHTAVYNAAHDGKLQLLQKLLSGRSREELDELMGEVTTGGTPLLIAARYGHLDVVRSL
LRRGASVNRTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGH
REIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCNARMERDGYGMTPLLAA
SVTGHTNIVEYLIQEQPGQEQTPPGLIQEGSSTSQGCLQGARSCSSSAEEQVNSESYESC
CPTSREAAVEALELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPQQLVLAYD
YSREVNTSQELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERC
IHLWKYALDMQQMNLEPLSPMTASSFLSFAELFSYVLQDRAAKGSQGTQIGFADLMGVLG
KGVREVERALQMPKEPGDSAQFTKALAIILHLLYLLGKVECSPSQEHLKHQTVYRLLKCA
PRGRNGFTPLHMAVDKETTNVGRYRVGTFPSLHVVKVLLDLLLDCGADPDSRDFDNNTPL
HIAAQNNCPAIMSALIEAGAHMDATNAFKKTAYELLDEKLLARSSVQPFNYVTLQCLAAR
TLDRNKIPYKGFIPEELEAFIELH
Download sequence
Identical sequences G5C0R5
HGL_H00000269856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]