SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000269886 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000269886
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.06e-79
Family BAR domain 0.0000000166
Further Details:      
 
Domain Number 2 Region: 454-545
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-25
Family SH3-domain 0.00047
Further Details:      
 
Domain Number 3 Region: 321-361
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000488
Family BAR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000269886
Sequence length 560
Comment SH3GL1 (Homo_sapiens) SH3-domain GRB2-like 1
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVAEVLVRTIEYLQP
NPASRAKLTMLNTVSKIRGQVKSPGYPQSEGLLGESMIRHGKELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFEESKEVAETSMHNLLETDVEQVSQLSALVDAQLDYHRQAMQILEELADKL
KRRVREASSRPRREYKPKPREPYDLGEPEQSNGGFPCAPAPKATASSSFRSSDKPIRTPS
RSMRECPSLRTAGTGCFRGSLLPFSLMEVEQVSQLSALVDAQLDYHRQAMQILEELADKL
KRRVREASSRPRREDKPKPREPYDLGEPEQSNGGFPCAPAPKATAPKATASSSFRSSDKP
IRTPSRSMRTPCPEQWKEGLPALSTFVPSHLGSPPHPLAPLDQPSCKALYDFEPENDGEL
GFHEGDVITLTNQIDENWYEGMLHGQSGFFPLSYVEVLVPLPHTRCHHQLQGPPPSFPPR
SSTKALESERPRSLLPAPSP
Download sequence
Identical sequences G5BZA3
HGL_H00000269886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]