SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000270617 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000270617
Domain Number 1 Region: 766-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 710-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 808-860
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-17
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 654-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 572-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000528
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 241-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000121
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 9 Region: 340-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000825
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 10 Region: 200-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000277
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 426-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000304
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 12 Region: 6-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000915
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 
Domain Number 13 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000002
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000270617
Sequence length 867
Comment ZNF473 (Homo_sapiens) zinc finger protein 473
Sequence
MMEEFATHDMGMDFTLEDWEQPGLDQGDLFWDTALDNYQNLPMLNPPRPSPTSHPDGEEE
LVALMRGSPEGMGPGMSETKNSPLKQNFLEEGLSQGIMEVFYKDDPWNSRLEVCLDESWL
DNLQRDPESLQKSDDVTNNESTTESSSHELSHLSPCLLSIGEDSVTGVTEKSLTLAESKE
YRSDFAYSPDQRQQDVVLGEEKPYKCSECEESFSHGNDLIQHWVTHIREEPSEHQEDQRD
FSLTSYLSVCPVTHRGYRSYICKECGKTFSQNMQLQRHQKIHSREKPCKSQGGNCPSSYH
GEPIKHQKTPRSPKSYKCNKCDMTFTQALHLIGHRKTHTRKHYECVTCQAVFTLRKHFIQ
HQKTHAVKTTSECQECGKTFKRRLSLIKHQAIHTGEKPYKCDECGKGFSHTSTLKIHQKV
HSRERPYKCSDCSKAFSWKTHLHEHQQVHTGSRPHKCQECVRSFSRPSHLIRHQATHAME
RLFGCAECSQTFSNKEYLVRHQKIHTIEAPYECLECGECFVCNSTLNCHLSVHAREKQRF
DGTRKVLDQNLGQREHPRPDEKHFKCDKCGKAFNRNRYLTQHKKIHTRVQVFECNQCGKA
FSQRTQLLCHQTVHSGKRPHECGEDEEVVLRTSLTRHQPSQSEHPFKCNECGNTFSQSTH
LSEHQLIHTTKKPFKCNECERVFTQSNYLVQHQKAHVTKKHFLCSECGKMFHQSSCFSKH
LRTHTGEKPFECGECGKAFGMNAELIRHRRVHTGEKPYLCQDCGKAFSQSSCLSIHRRVH
TGEKPYLCSECGKAFTQRANLTQHERIHTGEKPYACGVCGKAFGFSAHLTQHQRSHTQEK
PYQCQHCQKAFKCFFTLIRHQRVHARK
Download sequence
Identical sequences G5B8S0
HGL_H00000270617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]