SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000271234 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000271234
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.4e-77
Family FCH domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 512-584
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-17
Family SH3-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000271234
Domain Number - Region: 389-456
Classification Level Classification E-value
Superfamily HR1 repeat 0.0144
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000271234
Sequence length 641
Comment FNBP1L (Homo_sapiens) formin binding protein 1-like
Sequence
MWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEEPRF
TSCIAFFNILNELNDYAGQREVVAEEMAHRVFGELMRYAHDLKTERKMHLQEGRKAQQYL
DMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENK
NEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISK
CLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTISASKQDS
GKVDAKSTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTFSIEPVHYCMNE
IKTGKPRIPSFRSLKRGGPALEDFSHLPPEQRRKKLQQRIDELNRELQKESDQKDALNKM
KDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGGRGDRRHSSDI
NHLVTQGRESPEGSYTDDANQEVRGPPQQHSHHSEFDDEFEDDDPLPAIGHCKAIYPFDG
HNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEKNSKETKISLDF
YRDTVKAGDSRGLQGEVEQNSECCVLQQLVNDSSPSICHIP
Download sequence
Identical sequences G5B698
HGL_H00000271234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]