SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000271628-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000271628-1
Domain Number 1 Region: 12-183
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.37e-50
Family Canonical RBD 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000271628-1
Sequence length 486
Comment SF3B4 (Homo_sapiens) splicing factor 3b, subunit 4, 49kDa
Sequence
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
FLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTF
SAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKK
DSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPAVGGE
EEEEKTLREWDTEAMIDERGEWSEIVVKKIVAFLLELDHLEYWQEGKELTLPTDARLRQA
CHLLAPSHRQYHLPERSHLEYRQLCPHHLCLGLLEDMVPAGTPGAGHPGHGHSHPHPFPP
AGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPF
GSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPL
RGPLPQ
Download sequence
Identical sequences G5BH25
HGL_H00000271628-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]