SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000271915 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000271915
Domain Number 1 Region: 576-649
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.66e-33
Family Small-conductance potassium channel 0.0000259
Further Details:      
 
Domain Number 2 Region: 341-496
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.98e-25
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000271915
Sequence length 739
Comment KCNN3 (Homo_sapiens) potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3
Sequence
MXXXQPAPPPHPLPQLAPLQRQLVHPGLLHSSPTAFRGPPSANSTAALHPSSRQGSQLNL
NDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPLSRLS
ASRRNLIEAEPEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHRHAGTTASS
TTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYSKD
SMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLV
CAIHPIPGEYKFFWTARLAFSYAPSRTEADVDIILSIPMFLRLYLIARVMLLHSKLFTDA
SSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTS
NFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAE
KHVHNFMMDTQLTKRMAPSPAPEFCLSPFISQGLSEKAGWVGAGPALTLPSRDSSLPRAR
RLQQVPWAAEFPGPWMETFSPRKDLIRVRFLGKQWIKNAAANVLRETWLIYKHTKLLKKM
DHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVVYDLITELNDRSEDL
EKQIGSLEAKLEHLSASFNSLPLLLADTLRQQQQQLLTALLEARAVSVAVGTTPAPLSDS
PIGVSSTSFPTPYTSSSSC
Download sequence
Identical sequences HGL_H00000271915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]