SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000272367 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000272367
Domain Number 1 Region: 459-600
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-41
Family C-type lectin domain 0.00032
Further Details:      
 
Weak hits

Sequence:  HGL_H00000272367
Domain Number - Region: 223-427
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000272367
Sequence length 605
Comment CLEC4F (Homo_sapiens) C-type lectin domain family 4, member F
Sequence
MDGNAVHFCTDNQCVSLHPRGMDPVTVAPTAPKMLKLIQGAMIFIAVTLVSSLVALFVGA
LQPRNPTSEEHPSFQDFQVMFPGDNTTEQLPVELNSHYYFGRVQDTIQIFKSHMENSSTW
HVEIQMLKCRVDNVSSQVQVLGAHLGDTRADIQMVKGALQEASALSLQTQMLGNSLEGAN
AEIQKLKGDLEKATALTFQTQDFLKSSSENTSVELYMLSRGLESVNTEIRMLKAGLEMAN
TQASLANSSLKNANAEINTLRGHLDSVNDLRTQNQILRSSLEGAQADMQRLRGSLQNANT
LNSQTQTLLKGSLDNTRAEILILRGHLEMAGNEMHLLKGDLETVTTQTQLANGHLEQTDA
QIQVLKAELENANTLNSQIQILNGQLKTASTEIQTLKQGMKDTAALNSQMQMLGSNLQKV
SAEMQKLKGDLENTKTLTAKIQEEQSSLGTLRAIIASLEQLQTTQNQLLQLLLQGWKVYG
GNLYYFSHVKKPWHEAEQFCVSQGAHLASVTSQEEQVRVAGFTSTSYYWIGLTDRGTEGS
WRWTDGTPFNNAQSKRFWDKNQPDNWPHGSGQSEDCVHIQKKWNDINCNNSYQWVCKKKT
GLAMA
Download sequence
Identical sequences G5B4Y8
HGL_H00000272367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]