SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000273183 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000273183
Domain Number 1 Region: 282-344
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00059
Further Details:      
 
Domain Number 2 Region: 102-160
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000987
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0034
Further Details:      
 
Weak hits

Sequence:  HGL_H00000273183
Domain Number - Region: 347-401
Classification Level Classification E-value
Superfamily SH3-domain 0.000381
Family SH3-domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000273183
Sequence length 403
Comment STAC (Homo_sapiens) SH3 and cysteine rich domain
Sequence
MIPPSGAREDGVDGLPKEAASAEQPPSPASTSSQESKLQKLKRSLSFKTKSLRSKSADNF
FQRTNSDVKLPADMLTEVSPSSSPLPAPGSLTSTPTRAGLHPNSGKAHALQEHIFKKPTF
CDVCNHMIVGTNAKHGLRCKACKMSIHHKCTDGLTPQRCMGKLPKGFRRYYSSPLLIQEQ
FGCIKEVMPIACGNKVDPVYEALRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEA
DGPGEGYELRKRSNSVFTYPENGTHDFSDQAKNVNHQEPLSKDPLQMNTYVALYKFVPQE
NEDLEMRPGDMITLLEDSNEDWWKGKIQDRIGFFPANFVQRVQQNEKIFRCVRTFIGCKE
QGQITLKENQICVTSEEEQDNGFIRVLSGKKRGLVPLDVLQNV
Download sequence
Identical sequences G5APQ7
XP_004857940.1.39548 HGL_H00000273183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]