SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000273450 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000273450
Domain Number 1 Region: 415-903
Classification Level Classification E-value
Superfamily ALDH-like 9.56e-163
Family ALDH-like 0.000000000903
Further Details:      
 
Domain Number 2 Region: 3-203
Classification Level Classification E-value
Superfamily Formyltransferase 1.44e-51
Family Formyltransferase 0.00000000302
Further Details:      
 
Domain Number 3 Region: 207-308
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.77e-26
Family Post formyltransferase domain 0.00000172
Further Details:      
 
Domain Number 4 Region: 327-408
Classification Level Classification E-value
Superfamily ACP-like 0.00000288
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000273450
Sequence length 904
Comment ALDH1L1 (Homo_sapiens) aldehyde dehydrogenase 1 family, member L1
Sequence
AAMKIAVIGQSLFGQEVYCHLRKEGHEIVGVFTIPDKDGKADPLGLEAKKDGVPVFKFPR
WRARGQALPDVVAKYQALGAELNVLPFCSQFIPMEVIDAPRHGSIIYHPSLLPRHRGASA
INWTLIHGDKKGGFTVFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVE
AVRLISEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEAC
GQKLTFFNSTLNTSDLVPEGEDLLIPGAHRPGMVTKAGLILFGNDDRMLLVKNIQLEDGK
MIPASHFFKGAASSALELTEAEVITAEAVRSAWQRILPSVPDIEDSTDFFKSGAASVDVV
RLVEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGEDEENECVIDYVEKAVNKLTL
YIPHQLFIGGMFVDAEGTKTYDAINPTDGSVICQVSLAQVSDVDKAVAAAKDAFENGLWG
KISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCD
KIQGCTIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKP
AQVTPLTALKFAELTLKAGIPKGVINILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHI
MRSCALSNVKKISLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVENS
IHDQFVQKVVEEVKKMKIGNPLDRDTNHGPQNHQAHLKKLLEYCQHGMKEGATLICGGNQ
VPRPGFFFEPTVFTDVEDHMFIAKEESFGPIMIISRFADGDVDTVLSRANATEFGLASGV
FTRDINKALYVSDKLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTV
TFEY
Download sequence
Identical sequences G5B0V1
HGL_H00000273450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]