SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000273612 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000273612
Domain Number 1 Region: 825-1129
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.26e-20
Family WD40-repeat 0.0081
Further Details:      
 
Domain Number 2 Region: 74-179,347-487,668-781
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000178
Family Armadillo repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000273612
Sequence length 1266
Comment VPRBP (Homo_sapiens) Vpr (HIV-1) binding protein
Sequence
MTTVAVHVDSKAELTTLLEQWEKEHGSGQDMVPILTRMSELIEKETEEYRKGDPDPFDDR
HPGRADPECMLGHLLRILFKNDDFMNALVNAYVMTSREPPLNTAACRLLLDIMPGLETAV
VFQEKEGIVENLFKWAREADQPLRTYSTGLLGGAMENQDIAANYRDENSQLVAIVLRRLR
ELQLQEVALRQENKRPRKLSSEPLLPLDEEAVDMDYGDMAVDLVDGEQEEASGDMEISFH
LDSSHKTSSRVNSATKPEGGGLKKNKSAKQGDRESFRKAKQKLGFSSSDPDRMFVELSNS
SWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYIDL
KQTNDVLLTFEALKHLASLLLHNKFATEFVAHGGVQKLLEIPRPSMAATGVSMCLYYLSY
NQDAMERVCMHPHNVLSDVVNYTLWLMECSHASGCCHATMFFSICFSFRAVLELFDRYDG
LRRLVNLISTLEILNLEDQGALLSDDEIFASRQTGKHTCMALRKYFEAHLAIKLEQVKQS
LQRTEGGILVHPQPPYKACSYTHEQIVEMMEFLIEYGPAQLYWEPAEVFLKLSCVQLLLQ
LISIACNWKTYYARNDTVRFALDVLAILTVVPKIQLQLAESVDVLDETGSTVSTVGISII
LGVAEGEFFIHDAEIQKSALQIIINCVCGPDNRISSIGKFISGTPRRKLPQTPKSSENTL
AKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACKALVGLSRSSTVRQIISKLPLFS
SCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSGKPLLIGTDVSLARLQKADVVAQFR
PISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNVFSGQEEASYNCHNSAITHL
EPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYVEFSKHSQDRVIGTKGDIAH
IYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMN
ISGVFHPNGLEIIINTEIWDLRTFHLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDDL
MEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNMD
TVCRLYEVGRQRLAEDEDEEEDQEEEEQEEEDDDEDDDDTDDLDELDTDQLLEAELEEDD
NNENAGEDGDNDFSPSDEELANLLEEGEDGEDEDSDADEEVELILGDTDSSDNSDLEDDI
ILSLNE
Download sequence
Identical sequences G5BZU1
HGL_H00000273612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]