SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000274361 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000274361
Domain Number 1 Region: 1046-1176
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-34
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 379-499
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.68e-30
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 3 Region: 1677-1866
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000188
Family Tetratricopeptide repeat (TPR) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000274361
Sequence length 1868
Comment ANKRD31 (Homo_sapiens) ankyrin repeat domain 31
Sequence
MQESHLCTGELKDPVKSVGLQLTSESCVSLYQEAKGSMLKGPEAENTEVLPYLEKELSED
RDSPEISLLSNIATTVSGMVAVEEKSLIETEKISAAPKKSYHPGKEVTLTMISKETNNEE
SSLETFVSALEKLLRSPESTQEKRLFKTMNDFDTGELMNALSNSSSSMSVSLSALSPYCR
DLLENAEDDALPPELLAALNTLSEDKTELICHRKKEGGSLRGRNEYLEPDSSQTNEDCTQ
ITETVKDSNPFESPSLARQNVTSCDPLNNKNPNPMDNGSDQETPCVLRRSSRLEELKISR
DAECTDDMYKMPEKIVPKMHSCEDQINNKSIENFRMQDPVLMIEDKKNISRFKGKQIRKN
ERLILKKEKLKINKMPLSGINRRNVFGETLLYRAALYDDADLVQCCIKKGANVNQPSYAG
WTALHEASVGGFYRTANELLKGGADVNIKGMYQITPLHDAVVNGHHKVAELLLLSGADPL
FRSDNGKCALDEAKDSRMKRLLEKYVPQCQKHLTSDQRKRIDTRDVEDVHQHKKTKFSPK
NRTGFVCNENSNRQKPEHVEVNKRSKEGFFINEDIYECYPQNSKITRFGKSKHKQSTLYQ
TYATGLKKGNLCNIKDTSTNVSEGKGRKNTQDKRTQANDGDCTSRQAIAISSSKRINTLV
TCQQHILQTLDDLSEESHEPSSPTLSSLKDGLVNSVAICSVSKEAHTRHLDLSEGQEMQF
FGLEYIGQTESGSFSTPSLHKEVKLPLVSTDQPHVYQEQQCSPYISHKNSNSGKKVKTFN
KWENSFLSFVKEHSYNYNGDFCIAETAITSEMVTCSTECKNYYQENLRNREERDFQQLLP
SEDHFLQESELKESSLTTFPQQEAVNISNSDKAVISEQHVANYEQCIYGTSFDHSFGNRE
QTSLACTRTVSTHEVSKLTSHVEKLKKPQDNSPRESTPLVNQIDTHIMEKVYVELKEETE
RNSSDKGQKPRLFPTVVHSQKIEIINVEKNNEYLPENELIPNKNFCSTKNMNKELTNISE
FNQQEKEISHKPVLLGKFAEMKTTGISKRNARGESQLHSAARRGDLSLVQILIESGADVN
LKDNAGWTPLHEASNEGFSDIIVELLKAGANVNCESIHGILPLHKAVASNHLKVTEILLQ
HGANPNQEDQTQKTALDEADNEKMKELLKSYGAIETNNRDESNAAVTVKSPTVWSKRYKQ
CLGVEDETVDPPTPSHQEERRENFPVHQTISAILQDIEENQETLLEFEIRNSKDAEQYIK
RMLEIKEIMDNVLSKQKAERDDLAKKYRVSVESFKHGVLREQLANLATRQKKLLVAAKKQ
KNISLKIQNYKNVTSLSGLPSRKLSSSLDISSDKESQELTRLENVVQPQLSPFSAVNLDC
GSVGETPLSPETWNDGQNTNICLNSKKFSRSEMNLKQNESDCTLDGFSNSIHSDTTEKIK
LSSQQATFIAQTEHSQKENDLIEMIAKDHEFCSPSATTSSLNISECTSSLSQNDPYLSTV
ISDQDLYHCDPKRRNKKTASQLPPGGVSESVAHQRSAVLGTYTGHALKPCLKKAASAIPR
ANDRQISSSFESSHQHTIKNPSSFSTTPKKKCMEIKDLMLLGRINPGNNILEFRTQETTH
KASILMSGKIKVENGQIYQNPVTWLKDLLGGDSYVTWNYAWILQDGSSGSGGVSVPALWS
EVNHYRQNGDFTQALKTINKINKDNITALHCKVVCLIQNGSFKEALNVINMHTKVLANNT
VSFEKEHCEYRLNRIESALKATESANQKTEKLKDLYGKVLYRLERYDECLAVYRDLMRKS
QDDYDEKRKTNLSAVVAAPSNWEKMVPENLGLQEGTHELCYNTACALIGQGQLSQAMKIL
QKAKDLCH
Download sequence
Identical sequences G5AVZ5
HGL_H00000274361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]