SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000274364 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000274364
Domain Number 1 Region: 1168-1295,1327-1532
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-77
Family p120GAP domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 6-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-37
Family Calponin-homology domain, CH-domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1762-1860
Classification Level Classification E-value
Superfamily RGC domain-like 1.83e-33
Family RGC domain 0.00000995
Further Details:      
 
Weak hits

Sequence:  HGL_H00000274364
Domain Number - Region: 820-853
Classification Level Classification E-value
Superfamily WW domain 0.00334
Family WW domain 0.0045
Further Details:      
 
Domain Number - Region: 973-1034
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0196
Family Motor proteins 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000274364
Sequence length 1860
Comment IQGAP2 (Homo_sapiens) IQ motif containing GTPase activating protein 2
Sequence
MDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMV
SEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRKNIPRMIY
CIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANEL
SVDEAALHAAVIAINEAIEKGIPEQTIVTLRNPNAVLTLVDDSLAQEYQKELWGAKRKKE
ENSKLKNNCISEEERDAYEELLTQAEIQGNINKVNRLVAVDHINAVIQKGDPENTLVALK
KPEAQLPAVYPFAAVMYQNELSNLQRQNAMNYLAHEELLIAVEMLSAVALLNQALESNDL
VSVENQLRSPTIGFNNLDEAYVERESVQKLMELAYQTLREATTSIAQCAVQLFYSVRNIF
HLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHPLLTLGHQFRLCLASILCDGTTTFVD
LLPGFRRLGTECFLAQMWVQKGELLERLSSARNFSNMDDEENYSAASKAVRQNYLAHEEL
LIAVEMLSAVALLNQALESNDLVSVENQLRSPTIGFNNLDEAYVERYTSALLSFKLEAIS
QGQDNLSWNEIQNCIDMINAQIQEENDRIIAIGYINEAIDEGNPFKTLDTLLLPTAKIKD
VNPAHSQHYQDVLHYAKSQKLMDPESVSKVLWLEEIQQAINEANLDEDRAKQWATLVIEV
NRCLEEQKSDDILSVLKSYASNAQNIISECADGYYKALVKAKESKPESVMWLLQRGLWHL
DGVSRLPNLSQILSLPRVLRLRPLTVEKQLSMFTVDHLRPMSTEGSWLKLSLQEKYDYYY
NIDSKESSWVTPESWVPKESWLKREEIEDIIEEVTVGYIREKMWNASEDLLLRFQATSSG
PMLREQFEARKSFLHDQEENVVKIQDIIEEVTVGYIREKMWNASEDLLLRFQATSSGPML
REQFEARKSFLHDQEENVVKIQAFWKGYKQQKAYLLRRQTFAGNVDSIVKIQSWFRMATA
KKNYLSRLQYFKDHKNEIVKIQSLLRASKARDVYRTLVGSENPPLTVIRKFVHLLDQSDL
DFQEDLEVARLREEVVTKIRGNQQLEKDLNLMDIKIGLLVKNRITVEVSGLMRRKKLNKK
KGGEVEILNSIDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLAKLIFQMPQNKSTKFM
DTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRGA
RGQNTLRQLLAPVVKEIIDDKSLVINTSPVEVYKAWVNQLETQTGEASKLPYDVTTEQAL
TYPEVRNKLEASIESLRKVTDKVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDE
LLKIVGNLLYYRYMNPAIVAPDGFDIIDMTAGGQINSDQRRNLGSVAKVLQHAASNKLFE
GENEHLSSMNNYLSETYQEFRKCFKEACNVPEPEEKFNMDKYTDLVTVSKPVIYISIEEI
INTHSLLLEHQDALAPEKSDSLNKLLELLGSAPSVESFLGEGAVDPNDPNKENTLNQLSK
TEISLYLTSKYDIEDGSAIDGRSLMIKTKKLIIDVIRNQPGATLTEILETPATEQQEQDH
AKDMVSRAVMDSRSPEDGKQSQAMMEDAQLPLEQKKRKIQRNLRTLEQTGHVSSKNKYQD
ILNEIAKDIRNQRIHRKLRKAELAKLQQTLKALNEKAAFYEEQINYYDTYIKTCLDNLKR
KNTRRSIKLDGKGEPKGMKRAKPVRYTAAKLHEKGVLLGIDDLQTNQFKNVTFDIIATED
VGIFDVRSKFLGVEMETVQLNIQDLLQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK
Download sequence
Identical sequences G5ATK8
HGL_H00000274364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]