SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000275015 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000275015
Domain Number 1 Region: 99-319
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.15e-61
Family Ankyrin repeat 0.00000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000275015
Sequence length 359
Comment NFKBIE (Homo_sapiens) nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Sequence
MSEARKDPAEADDGQCDSGIESLRSLRSLPEPGPATPGDAKEDAEGERAYSAYDSVSLTE
PLPLPGVPEPEHPGPCSPLPPTGPLSAQQLEALTYISEDGDTLVHLAVIHEAPDVLLCCL
ALLPQEVLDIQNNLYQTALHLAVHLDQPGAVRALVLKGASLALQDRHGDTALHVACQRQH
LACAHCLLEGQPEPGRRPAHPQDLQLQNWQGLACLHIATLQRNQPLMELLLQNGADIDVQ
EGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLAAGRGLGSISSTLCQA
GADALLLNVEDETPQDLAEDVRRACSALLYGPPMPIAEPLTVLPFDDLKISGKPLLCAD
Download sequence
Identical sequences G5BNP0
XP_004846505.1.39548 XP_004846506.1.39548 XP_004846507.1.39548 HGL_H00000275015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]