SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000275423 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000275423
Domain Number 1 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 349-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 185-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 270-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000318
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 391-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000188
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  HGL_H00000275423
Domain Number - Region: 130-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00533
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000275423
Sequence length 434
Comment RBAK (Homo_sapiens) RB-associated KRAB zinc finger
Sequence
GPVSFKDVAVDFTQEEWQQLDRDEKMTYRDVMLENYNNLISVGYDVTKPNVIIKLEQGEE
PWTIEGDFSQTCPEVWKIDDLIERIQENEDEHTRQAVDIHSQTLTEERRDALDKICNVET
NLDPSSIIAHGCVSCGKRLETFSELISSDGSYARKKPDVCNECGKIYFIQMSNFNAYQSS
QIEMKPFECTECGKSFCKKSKFIIHQRAHTGEKPYECNVCGKSFSQKGTLTVHRRSHLEE
KPYKCTECGKTFCQKLHLTQHVRTHSGEKPYECSECGKTFCQKTHLTLHQRNHSGERPYP
CSECGKSFSRKSALSDHQRTHTGEKLYKCNECGKSYYRKSTLITHQRTHTGEKPYQCSEC
GKFFSRVSYLTIHYRSHLEEKPYECTECGKTFNLNSAFIRHRKVHAEEKLHDCGECGKFS
QSLYLTDHDTTHVG
Download sequence
Identical sequences G5BI81
HGL_H00000275423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]