SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000276079 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000276079
Domain Number 1 Region: 74-207
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.11e-34
Family Canonical RBD 0.0000222
Further Details:      
 
Weak hits

Sequence:  HGL_H00000276079
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0157
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000276079
Sequence length 471
Comment NONO (Homo_sapiens) non-POU domain containing, octamer-binding
Sequence
MQSNKTFNLEKQNHTPRKHHQHHHQQHHQQQQQQQQQPPPIPANGQQASSQNEGLTIDLK
NFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRT
LAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVI
VDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKL
VIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM
EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQE
EMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM
PDGTLGLTPPTSERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Download sequence
Identical sequences G5BW26
XP_004872705.1.39548 XP_004872706.1.39548 XP_004872707.1.39548 HGL_H00000276079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]