SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000276297 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000276297
Domain Number 1 Region: 885-1076
Classification Level Classification E-value
Superfamily Bet v1-like 6.32e-55
Family STAR domain 0.000000341
Further Details:      
 
Domain Number 2 Region: 633-845
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 9-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.33e-33
Family Variant SAM domain 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000276297
Sequence length 1089
Comment DLC1 (Homo_sapiens) deleted in liver cancer 1
Sequence
IPGISEKEKAEIEAKEACDWLRATGFPQYAQLYEDLLFPIDITLVKREHDFLDRDAIEAL
CRRLNTLNKCAVMKLEISPHRKRSEDSDEDEPCAISGKWTFQRDSKRWSRLEEFDVFSPK
QDPIPGSPDDSHLKNAMSNESMLTDLSEHQEVSSVRSLSSTSSVPTHVPHSGEAATPRTN
SVISVCSSSHFTGNDDSFCSLPSPKELSSFNFTMKGHEKSAKSKTRSLLKRMESLKLKGS
HHSKHKAPSKLGLVISSPILQEGIDEEKLKQLNCVEISALNGNHINIPMVRKRSVSNSTQ
TSSSSSQSETSSAVSTPSPVTRTRSLSACNKRVGMYLEGFDPFSQAAFNSVMEHNFKNQE
RYPEDMVFYIPEDHKPGTFPKALSSSSFCPMGNNSSVNWRTGSFHGPSHISLRRENSNDN
PKELKRHNSSSSMSSRLSIYDNVPGSILYSSSGDLADLENEDIFPELDDILYHVKGMQRI
VNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDGDHDRVTPSDLDSTGNSLNEPEEPAD
IPERRDSGVGASLTRCNRHRVRWHSFQSFHRPSLNSVSLQINCQSVAQMNLLQKYSLLKL
TALLEKYTPSNKHGFSWAVPKFMKRIKVPDYKDRSVFGVPLTVIVQRTGQPLPQSIQQAM
RYLRNHCLDQVGLFRKSGVKSRIQALRQMNESAMDCVSYEGQSAYDVADMLKQYFRDLPE
PLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREVLQTLLYFLSDVTAAVKENQ
MTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGLAHMIAE
CKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLSNNQSADYKHFLQDCVDGLFKEVKEK
FKGWVNYSTSEQAELSYKKVSEGPPLRLWRSTIEVPAMPEEILKRLLKEQHLWDVDLLDS
KVIEILDNQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALLLTSVDHDRAPVVGV
RVNVLLSRYLIEPCGSGKSKLTYMCRADLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQN
SETKDTKSR
Download sequence
Identical sequences G5ANJ0
HGL_H00000276297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]