SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000276925-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000276925-2
Domain Number 1 Region: 34-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.27e-42
Family Ankyrin repeat 0.00000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000276925-2
Sequence length 129
Comment CDKN2B (Homo_sapiens) cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Sequence
MDSWGEKLATAAARGRVQEVRELLEAGAPPNARNRFGRRPIQVMMMGNTQVAALLLLHGA
DPNCADPVTLTLPVHDAARAGFLDTLVALHRAGARLDVRDTWGRLPVDLAEEQGHREVAR
YLRDVVGDV
Download sequence
Identical sequences G5BA22
XP_004838409.1.39548 HGL_H00000276925-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]