SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000277541-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000277541-2
Domain Number 1 Region: 1423-1665
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-52
Family Ankyrin repeat 0.00000121
Further Details:      
 
Domain Number 2 Region: 437-552
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000926
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 301-438
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000502
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 726-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 543-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 926-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000401
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 116-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000044
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 152-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000821
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 235-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000353
Family EGF-type module 0.022
Further Details:      
 
Domain Number 10 Region: 889-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.008
Further Details:      
 
Domain Number 11 Region: 646-687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 712-845
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 13 Region: 853-888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000803
Family EGF-type module 0.054
Further Details:      
 
Domain Number 14 Region: 1140-1171
Classification Level Classification E-value
Superfamily Notch domain 0.00000085
Family Notch domain 0.0028
Further Details:      
 
Domain Number 15 Region: 195-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family EGF-type module 0.015
Further Details:      
 
Domain Number 16 Region: 24-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000521
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 688-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000734
Family EGF-type module 0.016
Further Details:      
 
Domain Number 18 Region: 1103-1133
Classification Level Classification E-value
Superfamily Notch domain 0.00000811
Family Notch domain 0.0065
Further Details:      
 
Domain Number 19 Region: 78-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000298
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  HGL_H00000277541-2
Domain Number - Region: 1020-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000101
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1062-1091
Classification Level Classification E-value
Superfamily Notch domain 0.0034
Family Notch domain 0.0037
Further Details:      
 
Domain Number - Region: 971-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 279-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.018
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000277541-2
Sequence length 1805
Comment NOTCH1 (Homo_sapiens) notch 1
Sequence
MAWTATWQQWCTPGFLGETCQFPDPCRDAQLCQNGGSCHALLPTAPSSPGAPSPLAPSFL
CTCTSGFTGKRCQTQLEDLCPPFFCAKKGRCHLEAPDRPQCSCMPGWTGDHCQLRDFCSA
NPCANGGVCLTTYPQIQCRCPLGFEGHTCERDVNECFLDPGPCPPGTSCHNSLGSFHCLC
PEGPEGSHCELRKGPCPTAGCQNGGPCQPVPGAGVSFHLCLCLPGFTGPDCEVNADDCVK
HQCQHGGACQDALGAYACLCPEPWTGWDCSEDVNECEVQGPPRCRNGGTCQNSAGGFHCV
CLSGWGGSSCEENLDDCVHATCAPGSTCMDHVGSFACLCPPGRTGLLCHLEDMCLSQPCH
GEAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFNCL
CPPGYTGSRCEADHDECLSQPCRPGSTCLDLLATFHCLCPPGFEGQLCEVQTNECASAPC
LNQADCLDLLNGFLCVCLQGYMGALCEEDVDECASSPCTNGGQCQDQPGAFLCECLPGFE
GPHCEAEVDECLSAPCAPGASCLDRSGAFSCLCPSGFTGQLCEVPLCAPTLCQPGQKCQG
QDKGVHCLCPDGSPGCGPAEDNCTCRHGHCHGSSCVCDVGWTGPECQEELGGCISTPCVH
GATCYPQPSGYNCTCPAGYTGPTCSEEVTACLSGPCLHGGSCSPSPGGYSCTCPPTHTGP
QCQTATDPCASAPCLSGGTCVSRPGAFSCLCASGFRGPRCEGKVHPSCADSPCRNRATCQ
DGPQGPHCLCPKGYTGGQCQTLVDFCAQTPCPHNSQCLQSGPSFQCLCFQGWTGPLCSIP
LSSCQKAALSQGIEVSALCRNGGLCVDGSSSHFCRCAPGFRGSVCQDSVDPCESRPCQNG
ATCTAQPNGYRCQCAPRYSGQNCSEELNACQSQPCHNLGTCTPRPGGFHCACPPGFVGLR
CEGDGFEGATCSHKAPSCGLHHCHHGGLCLPSPKPAFPPRCACLNGFGGPDCLTPPASQG
CGPPSPCLHNGTCSETPGLGGPGFRCSCPPDSPGPRCQKPGAKGCEGRGGDGACDEGCSG
PGGNWDGGDCSLGVPDPWKGCPSHSQCWLLFRDGQCHPQCDSEECLFDGYDCEPPPTCTS
AYDQYCRDHFHNGHCERGCDTAECGWDGGDCRPQEGDPEWGPSLALLVVLSPPALDQQLL
HLARVLSLTLRVGLWVKKDAEGRDMVFPYPGARAQEELSGPREPSPGRGAPQPQPPGKEQ
DSLSTGLVVVMGVDLSRCGPKQPAARCPWDPGLLLRFLAAMAGAGWGSVPLRPQAARSPL
PLGPWAPAPLPGCHGRRGGPGAAGAPAAAGCPSKLRHRSLKPEPEAEEEEGVVMCAGPKE
GEQAEETAPPPKRHLWPLSFGCGELPQVAMLTPPQESEAEASDVDTFGPDGGTPLMSAVC
CGAVASRTFQGTWLGSPEPWEPLPDGGACPQAHPSGTGETPLHLAARFSRPTAARRLLET
GANPNQPDRAGRTPLHTAVAADAREVCQLLLSSRQTAVDARTEDGTTPLMLAARLEVEDL
VEELIAARADVGARDKWGKTALHWAAAVNNARAARSLLQAGADKDAQDGREQTPLFLAAR
EGAVQVAQLLLRLGAARELRDHAGLAPGDIARQRNHWDLLTLLEGAGPAEARHKAAPGRE
AGAFPRARTTSASAPPRRGGACARARTLSGDLAARRGGAYPCGRSPSGGGEPARARRLFA
GVRGPRPSPAAVRGRPRAAADDWPRDWVTLGACGPAAATPGPPPCLTPSPERGPLKLPGV
SLSTE
Download sequence
Identical sequences G5C3I8
HGL_H00000277541-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]