SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000277549 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000277549
Domain Number 1 Region: 387-619
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-36
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Domain Number 2 Region: 1320-1560
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-33
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 999-1157,1194-1271
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.84e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 2-153,198-268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.02e-31
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Weak hits

Sequence:  HGL_H00000277549
Domain Number - Region: 1557-1604
Classification Level Classification E-value
Superfamily EF-hand 0.0408
Family Calmodulin-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000277549
Sequence length 2184
Comment CACNA1B (Homo_sapiens) calcium channel, voltage-dependent, N type, alpha 1B subunit
Sequence
PFEYMILATIIANCIVLALEQHLPDGDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFV
FHKGSYLRNGWNVMDFVVVLTGILATAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYMGKFHKACFPNSTDADPVGDFPCGKDAPAR
LCEGDTECREYWPGPNFGITNFDNILFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLY
FIPLIIIGSFFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELNGYLEWIFKA
EEVMLAEEDKNAEEKSPLDAVLKRAATKKSRNDLIHAEEGEDRFADLCAVGSPFTRTSLK
SGKTESSSYFRRKEKMFRFFIRRMVKAQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTAL
YFAEFVFLGLFLTEMSLKMYGLGPRSYFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGI
SVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQ
FNFKDETPTTNFDTFPAAILTVFQILTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTL
FGNYTLLNVFLAIAVDNLANAQELTKDEEEMEEAANQKLALQKAKEVAEVSPMSAANISI
AAAASYASSYGWPAVSARRHSRLFSVVIRSARCEALYSEMDPEERLRYATSRHLRPDMKT
HLDRPLVVEHSRDGPRGPTGGKAQSEATEAMDPPRRHHRHRDRDKAPTTLPSASEQAQDQ
AGAQRADRMDGAEPGARGEHARXKDKDKDGPVAKGERRARHRGPRAGPKEAESGEEPGRR
HRARHKAPPTQEAMEKEGEGPEGDQEVRSRQLKDPPCDLEARGVMGVDPVHALPSTCLQK
VEEQPEDADNQRNVTRMGSQPSDPSTAVHAPVTLTDPAGETTAVPSGNVDLESQAEGKKE
VEADDMLRSGPRPIVPYSSMFCLSPTNLLRRFCHSIVTMRYFETVILVVIALSSIALAAE
DPVRTDSSRNNALKYMDYIFTGVFTFEMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGA
LVAFAFSGSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYM
LFMFIFAVIAVQLFKGKFFYCTDESKELERDCRGQYLDYEKEEVEAQPRQWKKYDFHYDN
VLWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSPGFRMELSIFYVVYFVVFPFFFVNI
FVALIIITFQEQGDKVMSECSLEKNERACIDFAISAKPLTRYMPQNRQSFQYKTWTFVVS
PPFEYFIMAMIALNTVVLMMKFYDAPYEYELMLKCLNIVFTSMFSMECVLKIIAFGVLNY
FRDAWNVFDFVTVLGSITDILVTEIANNFINLSFLRLFRAARLIKLLRQGYTIRILLWTF
VQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALDDDTSINRHNNFRTFLQALMLLFRSA
TGEAWHEIMLSCLSNRACDPNANASECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFE
YLTRDSSILGPHHLDEFIRVWAEYDPAACGRISYNDMFEMLKHMSPPLGLGKKCPARVAY
KRLVRMNMPISSEDMTVHFTSTLMALIRTALEIKLAPAGTKQHQCDAELRKEISSVWANL
PQKTLDLLVPPHKPDEMTVGKVYAALMIFDFYKQNKTTRDQIHQAPGGLSQMGPVSLFHP
LKGTLEQTQPAMLRGARAFLRQKSSTSLSNGGAIQTQESGIKESVSWGTQRTQEALYEAR
APLERGHSAEIPVGQRGTLAVDVQMQSAALRDPDGEPQPGLQSQGRAASMPRLAAETQPA
PDASPMKRSISTLAQRPHGAHLCSAALDRLAPGQVPHHHHHRCHRRRDKKQKSLEKGPSL
SADTDGAPSSTPGPGLAPGEGPAGCRHERRQGRGRSQERRQPSSSSSEKQRFYSCDRFGG
REPPQPKPSVSSHPTSPTAGLEPAPAPQGGGSVTGSPLLSTSGASTPGRGGRRQLPQTPL
TPRPSITYKTANSSPVHFGGAQSSLSAFSPGRLSRGLSEHNALLQRDPLSQPLAPSSRIG
SDPYLGQRLDSEASAHALPEDTLTFEEAMASNSGRSSRTSYVSSLTSQSHPLRRVPNGYH
CTLGLSTGGRARHSYHHPDQDHWC
Download sequence
Identical sequences G5BG05
HGL_H00000277549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]