SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000277903-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000277903-1
Domain Number 1 Region: 403-671
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-70
Family Eukaryotic proteases 0.000088
Further Details:      
 
Domain Number 2 Region: 280-385
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-28
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 176-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000199
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 220-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000352
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000277903-1
Sequence length 674
Comment HABP2 (Homo_sapiens) hyaluronan binding protein 2
Sequence
MQQLSQSEQKVDSDWRLMCLFEDCWGAGSWLFGGPVPAICSKQAISWNCLDEILPPIKAA
VSLSCPAVSKVIAIDLGAGLLFQKLRARQQPCDHQLVLSVGPVMLGRLQLGIRKTANASL
CADSLTLLHNQFFLKLLPHDLDPDWTPDFYDYSYEENIQDENTNTSLAYSENPDWYYADD
DPCQSNPCEHGGNCVISGDTFRCSCQPPFSGNRCQNVETRCRNNPCGQGECLITQSPPYY
HCACKHPYTGPDCSRVLPVCRPNPCQNGGLCSRHRRRSKFSCTCSEQFKGRFCEIGSDDC
YVGDGYSYRGRVSRTVNQHTCLHWNSHLLMQENYNMFMEDAEGHGIGEHNFCRNPDGDQK
PWCFIKANSEMVKWEYCDVSACSALDTANPEQRPVDSPIQHLGFDSCGRTEVAERKIKRI
YGGFKSTVGKHPWQASLQTSVPLATSIPQGHFCGGALIYPCWVLTAAHCTDIKTKHLKVV
LGDQDLKKTEFHEQTFRVEKIIKYNHYNERDEIPHNDIGKSPLSWPSSLLKLKPVDGHCA
LESKYVKTVCLPDDSFPSGTECHISGWGVTETGEGSRQLLDAKVKLIASTLCNSRRLYDQ
TIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKNGIYYVYGIVSWGQECGKKPGVYTQVTK
FLNWIKTTMQKEAV
Download sequence
Identical sequences G5BKD5
HGL_H00000277903-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]