SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000278070 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000278070
Domain Number 1 Region: 1487-1598
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000163
Family Canonical RBD 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000278070
Sequence length 1660
Comment PPRC1 (Homo_sapiens) peroxisome proliferator-activated receptor gamma, coactivator-related 1
Sequence
MAARRGRRDRVVPPASAGSGPDPGGGVRGSGWGSRSQAPYGTVGAMSGGEQALLHEEGDD
SGFVSLSRLGPSLRDKDLGMEELILQDETLLGTMQSYMDASLISLIEDFGSLGESRLSLE
DQNEVSLLTALTEILDNADSENLSPFDSIPDSELLVSPREGSSLHKLLTLSRTPPERDFI
TPVDPLGPSTGSNRVSGVEMSLADPPWDFSPPSFLETSSSRVPGWRSSRSRLRWGQSPPS
QQRSDGEEEEEVASFSGQMLAGELDSSMSTIPDFPMHLACPEEEDRATAAEVAMPSAGDE
SISSLSELVRAMHPYCLPNLTHLASLEDELREKQEELTLPEGCVVLEIVGQAATAADGLQ
IPVVVRQIPTGPESVLLDDPLQLFLPTLESETEAAVPKVVPCPQKEELLLDSACLLEPRE
ATEPLGPSGPQNPPPSAVLGSQKARRGRRKKSKEQTAATSVEGYARRLRSSSRGQPTVAT
GVASQTGNLQKQPQEELQRVAGAPRGXGKPRAWAQAWAAALEKPSSGDVDKSAGQGSLAK
EDPLDLYSKLVDTIQANPVLTHLPLVNSAQAAPMPVDSIEARLTAVDPALADPVPADPAS
ASSELVEPLPADPVLTDPVLADSAAADPTVVAPISDLSPVETVLADPVPVDSVPNDTAPA
DPVLVKSRPTDPRRGAVSSAQGNPASQLPWDSESSDPLKAVIPEGKEVVGPLKVESGTSA
PTQETKPRPLSLSEYRQRRQQRQAEAEERSSQPPAGKWPSLPETPTGLADIPCLVPPAPA
KKTALQRSPEAPPEACFVPVGPSPASPSPEPATKPVVSTPPEKVPPEEVPLPARPSLPIV
QSMSPARPIPSTMPTPSTMPTPLPFPPSGLGIPPTLPLPASGQVAPSPPPPPLQPSGLPV
SMAPVPPDPYAHYAHVPPWPCYPPVSPGYPCLPPPPVVPLVSSTPSTYAMAPTCNVPWVP
PPAPVSPYSSSCTYGPMGWGPRPQHPPFWPAVPPPPLLPASVGRNVPPPMVEPNAIPAGA
PENVLPVPMAPSLSLGAAGHEAPQVEATKVEVKSVPASPHVKHKVSSLVQTPRTKAPPSL
SAEGVAVEESASEGLKPEVQESKLKEKPLCPAVRAVSIPRQSTVPKLPAVHPARLRKLSF
LPTPRTQGPEDVVQALISETGIEASDLSSLLEQFEKSEAKKECPPLAPADSSAVGNSGSV
DTPQEKRPLDRLQAPELANVAGLTPPATPPHQLWKPLAAVSLLAKAKSPKSTAQEGTLKP
EGVTEAKHPAAAYLQEGVCGPSPVHVGSGDHDYCVRSRTPPKKMPGLVIPEVGSRWNVKR
HQDITIKPISSLSPADPLLPCPATSQGPLDHRTSSEQALAPAPCLAPSALLSPETSPCRN
DTNTRTPPEPPANQRSMRYYRKACRSASPPSRGWQGHRGHSSRSVSSGSNRTSEASSSSS
SSSSSSSRSRSRSRSLSPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSSSSRSRSR
SPSPRRRSDRRRRYSSYRAHDHYQRQRVLQKERAIEERRVVFIGKIPGRMTRSELKQRFS
VFGEIEECTIHFRVQGDNYGFVTYRCAEEAFAAIESGHKLRQADEQPFDLCFGGRRQFCK
RSYSDLDSNREDFDPAPVKSKFDSLDFDTLLKQAQKNLRR
Download sequence
Identical sequences G5CAG7
HGL_H00000278070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]