SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000279259 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000279259
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.76e-19
Family Ubiquitin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000279259
Sequence length 133
Comment FAU (Homo_sapiens) Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Sequence
MQLFVRAQDLHTIEVTGHETVAQIKAQVASLEGIAPEDQVVLLAGKPLEDDATLGQCGVE
ALGTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV
PTFGKKKGPNANS
Download sequence
Identical sequences G5B6L6
HGL_H00000279259 XP_004852478.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]