SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000279593 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000279593
Domain Number 1 Region: 318-423,545-661
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.22e-56
Family Phosphate binding protein-like 0.0000000413
Further Details:      
 
Domain Number 2 Region: 3-243
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.16e-22
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000279593
Sequence length 1334
Comment GRIN2B (Homo_sapiens) glutamate receptor, ionotropic, N-methyl D-aspartate 2B
Sequence
DESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGW
ELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWI
VPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEP
KSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKWERVG
KWKDKSLQMKYYVWPRMSPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQ
KRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGM
IGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSAD
VWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNS
VPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDF
SPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLN
YMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWL
TGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHCFMGVCSGK
PGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMANLSGVNGS
PQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERTFGNLQLKD
SNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSLGKKPLDIGLPSSKHSQLSD
LYGKFSFKSDRYGGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSLKKRPASAK
SRREFDEIELAYRRRPARSPDHKRCFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKE
RSDDFKRDPLGGGGPCANRSHLKHGAGDKHGVVGGVPAPWENNLTSWEDEDRAGANFCRS
CPSKLANACIRCEACKKAGNLYDISEDNSLQELDQPAAPVAVASNAASAKYPQSPTNAKA
QKKSRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFVDGSPYAHMFEMPAGDGTFA
NSKSSVPAAGHHHHNNPGGGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPT
VAGASKARPDFRALVTNKPMVSALHGAVPGRFQKDICIGNQSNPCVPNNKNPRAFNGSSN
GHVYEKLSSIESDV
Download sequence
Identical sequences G5BCQ0
HGL_H00000279593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]