SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000280082 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000280082
Domain Number 1 Region: 23-117
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000163
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000280082
Sequence length 628
Comment MIA2 (Homo_sapiens) melanoma inhibitory activity 2
Sequence
MAEIGIHRLLLFVISLTEYLEGTKLLADLKKCGDLECETLISRVLAVRDYTGPDCLYLNF
TKGEEISVYVKLAGEREDLWAGSKGKEFGFFPRDAVQIEEVFISEEVQISTKESDFLCLL
GVSYMFENEHSDLNNDNSENIYPYEEDRDLTYSIYESDFQIKPVFYATPPSTWFEDQFPA
SEAPEDIRSASESNGWEEAEASSVEQDHIPEVNYVSSPLPVREVQGRFGLGTEQAQEKAI
ESVTEPVQESSFRSRKIAVEDENDLEELNNGEPQTDHKREPESEFESVPEEQPEQAHDLE
HILKPEATGWFGSGFISYLGFGEEDTGNLPLQDFPYSISSDEEATVPCTEMLTEKEDTIT
NDSSILKPSWFDFGFGVLSFAYANEDKIISGDGKNEEDSGVNKHEHPHASEFNSDKEEEI
KMIKIIETEDQTEKEKVFEKTDDSDTMPYLKKFLYSFDSPWSFENIPKETELPIPEQILD
QNYVVEREETEEFSLENYPTDNVKDLVMLDNRYSQSELSMRIHEAASFKTSSSKNNDEKS
KFPGDSEEPAQVEIDRSVENTIPDSQMVSTDNALSPHNYIPQKEDGSRFQILKYLFQIDI
CDVMTSVFSPIVLLSEWVSCSFKSFAIM
Download sequence
Identical sequences G5C810
HGL_H00000280082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]