SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000280758-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000280758-2
Domain Number 1 Region: 214-388
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.64e-26
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 550-657
Classification Level Classification E-value
Superfamily POZ domain 2.04e-23
Family BTB/POZ domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000280758-2
Sequence length 740
Comment BTBD11 (Homo_sapiens) BTB (POZ) domain containing 11
Sequence
GVLSLPDSLNLHREPQRAAKPGELPMFSQSELRTIEQSLLATRVGSIAELSDLVSRAMHH
LQPLHAKHHGNGTPLHQRQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVSLQVERT
FLPLQKLVEPPEPSPCREGPRRSRGTPRRPGAAPLGLHHAALGRPGAELLPGLPGVRRSP
SWLLADDCFCASRKLDAVAIEAKFKQDLGFRMLNCGRTDLVKQAVSLLGPDGINTMSEQG
MTPLMYACVRGDEAMVQMLLDAGADLNVEVVSTPHKYPSVHPETRHWTALTFAVLHGHIP
VVQLLLDAGAKVEGSVEHGEENYSETPLQLAAAVGNFELVSLLLERGADPLIGTMYRNGI
STTPQGDMNSFSQAAAHGHRNVFRKLLAQPEKEKSDILSLEEILAEGTELADTAPPTLCA
SRNSKAKLRALREAMYHSAEHGYVDVTIDIRSVGVPWTLHTWLESLRIAFQQHRRPLIQC
LLKEFKTIQEEEYTEELVTQGLPLMFEILKASKNEVIGQQLCVIFTHCYGPYPIPKLAEI
KRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHKVLLFTASPRFKALLSSKPANDSTCIE
ISYVKYPIFQLVMQYLYYGGPESLLIKNNEIMELLSAAKFFQLDALQRHCEIICAKSISA
DNCVDIYSHAKFLGVTELSAYCEGYFLKNMMVLIENEAFKQLLYDKNGERTGQDVLQDLQ
RTLAIRIQSIHLSSSKGSVV
Download sequence
Identical sequences G5BPD8
HGL_H00000280758-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]