SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000280772 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000280772
Domain Number 1 Region: 434-828
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.7e-132
Family Ankyrin repeat 0.000000000186
Further Details:      
 
Domain Number 2 Region: 76-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-112
Family Ankyrin repeat 0.000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000280772
Sequence length 3264
Comment ANK3 (Homo_sapiens) ankyrin 3, node of Ranvier (ankyrin G)
Sequence
MAHAASQLKKNRDLEINAEEETEKKRKHRKRSRGRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
ANVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTSLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETVTTTTVTEKHKMNVPETM
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAE
GYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSL
RHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI
TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVL
RSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRI
KQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKTLGSKATFS
PIVTVEPRRRKFHKPITMTIPVPPPSGEGAPNGYQGDTTPNLRLLCSITGGTSPAQWEDI
TGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVSLATQLYRELICVPYMAKFVVFAKM
NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGG
QQLVFNFYAFRENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHK
KTEKADKRQSFASLALRKRYSYLTEPGMSSPEDDTLEQVSFLDSSGKSPLTPETPSSEEV
SYEFTSKTPDSLIAYIPGKPSPIPEVSEESEEEEQAKSTSLKPTTVEKTTIEREMPSDVN
KDSVQRPKSNRVAYIEFPPPPPLDADHIESEKQHHHLPEREVDMIEVSLQDEHDKYQLAE
PVIRVQPPSPVPPGADASDSSDDESIYQPVPVKKYTFKLKEVDDEQKEMSKSKASAVKAS
NQKELESNGSGKDNEFGLDSTQNETAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDG
YDLQDEDDGLTESDSKLPSQTMEMKKDVWNTEGILKPADRSFSQSKLEVIEEEGKVGPEE
DKPFSKSSSSERTPDKTDQKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVAT
KGLDFDPWSNNRGDDEVFDGKSREDETKPFGLAVEDRSPATTPDTTPARTPTDESTPTSE
PNPFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDKSMITAT
PQPQSGDTTVETNLERNVEAPTVEPTPSSPTSGECQEGTSSSGFLEKSAAATNTSKVDPK
LRTPIKMGISASTMTMKKEGPGELTDKIEAGMPSCQGLENEALTVISNTANSQMGASPQE
KHDFQKDNFNNNNNLDSSTIQTDNSNVVLTEHSAPTCTTEKANPVKSSSGKKTGVLQGHC
TRDKQTTLGEQQKTKESIGIRRKSKLPIKATSPKDIFPPSRMPNIKASKTKQVSCYEKAR
PFTASSCVDMKSRIPVKNTHRENLVSVRKACAIQRQGQSEQSKARQLPSKLPVKVRSTCV
TATTTTTTTTTTAKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEDKKMQSELSDEE
ESTSRNTSLSETSRGGQPSVTTKSARDKKTEAAPLKSKSEKSGSEKRSSRRTADALTSVL
TKINRIDIVTLLEGPIFDYGNISGTRSFADENSVFHDPVDGYPPLQVELETPTGLHYTPP
TPLQQDDYFSDLSSIESPLRTPSRLSDGLVPSQGYVVQSADGPPVVTAEDTSLEDSKMED
SVPLTEMPEAVEVDENQLEDVCLSEYPQYLGSLAGVPKDVKAADPLKQTRKVGISSEQQE
KGKSGPDEEMTEEKLKSLFEDIQLEEGVESEEMTEEKVQAILKRVQQAELEMSSITGWQN
ETSSGNVDSPGQARRITGGLLDRLEDSPDQCRDSITSYLKGEPGKFEANGSHAEVTPEAK
TKSHFPESQNDIAKQSAKETLKPKMHGSGRAEEPPSPLAVYQKSLEETSKLIIEEPKPCV
PVSMKKMSRTSAADGKPRFNLHEEEGSSGSEPKELTNRLASLQQENKVLKIELETYKLKC
KALQEENRDLRKASVTILEMALRELGLLAFYHCGTRHQSCVLLVPHFSPQLAVKICLEFG
VCTWQCVFGRQQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLM
QLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQ
EALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVE
RLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLE
MDDERYFNEMSAQGLRPRTVSSPIPYTPSPSSSRPISPGLSYASHTVGFTPPTSLTRAGM
SYYNSPGLHVQHMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQ
PTIPSAAASQPAPSQHSVHPSSQP
Download sequence
Identical sequences G5BXS3
HGL_H00000280772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]