SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000281156 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000281156
Domain Number 1 Region: 30-150
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.35e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000281156
Sequence length 319
Comment KHDRBS2 (Homo_sapiens) KH domain containing, RNA binding, signal transduction associated 2
Sequence
EIEKFQGSDGKKEDEEKKYLDVISNKNIKLLERVLIPVRQYPKFNFVGKLLGPRGNSLKR
LQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSH
ALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAI
PPPPPPGRGVLTPRGTTVTRGALPVPPIARGVPTPRARGAPTVPGYRAPPPPAHEAYEEY
GYDEGHGGHYEEQSYEAYDSSYATQAQSVPEYYEYSHGVSEDAYDSYAPEEWAATRSSLK
APPPRSARGGYREHPYGRY
Download sequence
Identical sequences G5C5L5
HGL_H00000281156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]