SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000281419 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000281419
Domain Number 1 Region: 602-753
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.27e-65
Family Ankyrin repeat 0.0000000641
Further Details:      
 
Domain Number 2 Region: 77-305,338-363
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.64e-61
Family BAR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 455-598
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.000000961
Further Details:      
 
Domain Number 4 Region: 336-443
Classification Level Classification E-value
Superfamily PH domain-like 9.76e-22
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 916-995
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000281419
Sequence length 997
Comment ASAP2 (Homo_sapiens) ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
Sequence
MGPHLLCPCSLVVDAVEGTVISSLKLDCDQGHLLQVDEAGQELILWLLTELLCIAVCKQH
CTPGRGFVPLSNPMVLTALDVDRMALYKMKKSVKAINISGLAHVENEEQYTQALEKFGSN
CVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKGDLKKP
FDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRLFQLQMCEYLLKV
DEIKTKKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIEMLSTDLHTIKQAQDEERKQ
LIQLRDILKSSVQVEQKEDSQLRQSTAYSLHQPQGNKEHGMERNGNLYKKSDGIRKVWQK
RKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQEC
QIWMSVLQNSKEEALNNAFKGDDSTGENNIVQELTKEIISDVQKMTGNDVCCDCGAPVLS
TAHHKQIVRLAVAFSVHSLCVSDPTWLSTNLGILTCIECSGIHRELGVHYSRIQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDAVKPNPGSDMNARKDYIMAKYIERKYARKKH
TDSAAKLHSLCESVKARAIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTSKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
AKRLKHEHCEELLTQALAGRFISHVHVEYEWRLLHEDLDESDDDVDEKLQPSPNRREDRP
VSFYQLGSSQLPPIQTASSASTPWKTNSVGVDGVSRQRSSSDPPAVHPPLPPLRVTSTNP
LTSTPPPSVARPPPVLEALSQPSKAPPPEASQSKALPPQPPSRPPQKKPVPGADRPTPLG
SKGQPRGPEAAGALSNAAGLQPPAPMPRKSQVTKLKPKRVKALYNCVADNPDELTFSEGD
VIIVDGEEDQEWWIGHIDGDPSRKGAFPVSFVHFIAD
Download sequence
Identical sequences G5BEK6
HGL_H00000281419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]