SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000281513 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000281513
Domain Number 1 Region: 95-419
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000275
Family WD40-repeat 0.017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000281513
Domain Number - Region: 2032-2107,2158-2298
Classification Level Classification E-value
Superfamily ARM repeat 0.0785
Family Clathrin adaptor core protein 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000281513
Sequence length 2368
Comment NBAS (Homo_sapiens) neuroblastoma amplified sequence
Sequence
MAAPESSPALSPGIAEGEEETILYDLLVNTEWPPEIEVQPRGNRKQGASCIITKAIRDHL
LFLRQYIWYSPAPFLLPDGLVRLVNKQINWHLVLASNGKLLAAVQDQCVEIRSAKDDFTS
IIGKCQVPKDPKPQWRRVAWSYDCTLLAYAESTGTVRVFDLMGSELFVIAPASSFVGDLS
CAIAGLIFLEYKASAQWSAELLVTNYRGELRSYLVSVGTNQSYQESHRFNFSSHYPHGIN
TAVYHPAHRLLLVGGCGDSEVGVSRAASCGLFVWRVLSGSPYYKQVTSGGDSVTEAPKTL
GLLRMLSTKLYSHQGQEQDGIFKMSLSPDGNLLAAIHFSGKLSVWAVPSLRQLRVWEQSE
QPGYDDLNPDWRLSAEKRKKIKDKESLYPLIDVNWWADGAVTLARCSGALTIFSVKTLKN
LLGRSCEWFEPSPQVTATHDGGFLSLECEVKLVPKRSRLELRAGDEDDGEEDSDSDHEAS
AKARYFGYIKQGLYLVTEMERFAPPRKRPRTIMKNYRLVSLRSTTPEELYQRKIESEEYE
EALSLAHTYGLDTDLVYQRQWRKSAVNIASIQNYLVTKIKKRSWVLHECLERVPENVEAA
KELLQYGLKGTDLEALLALQRGVHTSRFTLPGDVDIDGVPYEELSAPLEELTRRQKEKAL
GRRHELLKLVNFSELTLEQKELCRCRLKLLTYLDRLATYKEILGVPHASEQRYDAEFFKT
FRRQNIVLSARIYARESNVAALEILFTYHGSDLLPHRLAILSNFPETTSPHQYSALLPEA
CHHGGSLVIIPWRERKHRAADWCEEAECRMVVEPSPQDGSEFLYATQPELLPFRTPQLAV
EEVMDWYRSRAEEIEHHAGQVDCALSLTRLGMERQIPGLLDLCDDLVTLETLVYEAGCDL
TLTLAELQKMKDIEKLRLLMNSCSEDKYVTSAYQWMVPFLHRCEKHSPGVAKELLREYLV
TLAKGDLRLPLKIFQHSKPDLQQRIIPDQDQLMVTALECIYSCVRSDQLPLCYGILECLP
QRGCGQKTQVTSALHDRVDQLQRILSVSEILEKHGIEKPISFVKDTQASAEEARKLMVRL
TRHTGRKQPPVGESHWRALLQDMLTVQQSVYTCLDPSACHEIFTESLLCSSRLENVQLAG
QLMHSGLANPPASAAQKGRLQYRVGYEKSVELVLAASREYFNSSTSLADSCMDLARCCLQ
LIADRPTAIQEELDLIQALGCLEEFGVKILPLQVRLCTDRISLIKECISRSPTCYKQSAK
LLGLAELLRVADEDLEERRGQVLILLVEQALRLHDYKAANVHCQELMATGYPQSWDVCSQ
LGQSEAYQDLATRQELMAFALTHCPPGSIEPLLAASSSLEAEILYQRVNSQIHLEGGESV
GVSPLIGKVPPEAEPGFPGSGSADLLSWTTAATMKVLSNTTTTTRAVLQAVSDRQWWKKS
LTYLRPLQGQEFGGSHQDGAVASEDLQKQGCHPFDGSVISNPFVPESGVTCDPCQPVPVE
SLAELLLRTGKLAEAGTEGQAVLPTTEVLLQLASDALPGDVTLALAYLLSLPQVLDANRC
FEKQSHSALSLQLAVYYYSLQIYARLAPCSRDNCHPVYRAHPKEVIRMVTSYVTRRGQEA
WPEDLASLTAHLHYYNEKLLDFTQAQLLQGLGKGVDVQRFTADDQYKRETILGLAETLEE
NILGIALSLAQRYGVSCWAVFMTHLEFLFTDSGLSTAEIETRAQAQLFETLKTDPEAFHR
HMAKYIYPSISGLDHERLLCYFTLLDSCGCADFGDPVMKPKTHIQLLKKFKVIAAGLNYK
KLTDGSTNPLEALEPVLSSQNILPISKLAPRIPKKDRGMLSASSLYTLWLQKLFWTGDPH
RLKQVPASPPEWLRAFDACVKYFDRLHPGDLITVLDALTFSAEAVTKLSVEVREEMTRKA
TATVTHLMEKSRKRNSEDDIQEASTSAVTYADALGHLQKSLAHLGTLGHSFVLSLKNSEQ
EALRRYSDLYDRSRSEKEPLHHLAVTMCLEGQPLGTIRQLLEVAVGPQDLSPKDVMRSAI
VRIISVLSGGSADLGGTGDPLRVLEGMIAAVHASVDSGEKCVTSACVCVTLWSLCGSRAL
CMLTSALPLSYILEQSFRLTEEDSRLLVFFRTEAILKAAWPGRQVDVADVASEEQRCALF
SELLDSSHREAEFQHLALLLHAWPPMRSEHAAGATRNPWLRLAAAMLRRWPAQSEENVGD
TVLRMCRSVHHTEQMLPAEAMKELCLLLRDRALLLPSLKLMLERPEPELRALVLEQVAAI
TQVDDSNCDPELLSLLLDAGLLVPCIPTRFYPHLIRHLLAEQGRWDEEQLAAQLRAAGHE
AEAGSLLLAVRGTHRALRTFRAALGTGQ
Download sequence
Identical sequences G5BET6
HGL_H00000281513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]