SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000281537 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000281537
Domain Number 1 Region: 398-506
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-22
Family PDZ domain 0.0000856
Further Details:      
 
Domain Number 3 Region: 156-259
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.028
Further Details:      
 
Domain Number 4 Region: 679-789
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000835
Family Nucleotide and nucleoside kinases 0.001
Further Details:      
 
Domain Number 5 Region: 507-583
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000591
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000281537
Sequence length 1726
Comment TJP1 (Homo_sapiens) tight junction protein 1 (zona occludens 1)
Sequence
MEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQEN
DRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPDPEPASDNEEDSY
DEEVHDPRSSRGGLANRRSEKSWARDRSASRERSLSPRSDRRSVASSQPAKPTRVTLVKS
RKSEEYGLRLASHIFVKEISQDSLAARDGSIQEGDVVLKINGTVTENMSLTDAKTLIERS
KGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRRSR
SRSPDQRSEPSDHSRHSPQQPSNGSLRSREEERISKPGAVSTPVKHTDDHAPRAVEEVTV
EKNEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPSMKLVKFRKGDS
VGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPK
GEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNG
KLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKR
NLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIA
KSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDS
KQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQ
QQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGA
YTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRIDS
PGFKTASQQKAEASSPVPYFSPETNPASSTSTVNHNVTLTNVRLEEPAPAPSASHSPQAE
AAHIMLRDQEPSLSSHVDPAKVYRKDPYPEEMRQNHVLKQPAVGHPGQRPEREPNLTYEP
QLSYVEKQPSRDLEQPTYRYDSSGYTDQFSRNYDHRLRYEDRIPTYEEQWSYYDDKQSYQ
PRPPFDNQHSRDIDSRQHPEESSERGYFPHFEEPASLPYDNRPRYEQPPRTSTLRHEEQL
TSGYGVQTRCRPEAQPFPSAGPKSSEPKQYFDQCPRSYEQVPPQGFTSKAGHYEPLHGAA
VVPPLVPSSQHKPEVLPPATKPLPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSASLEN
KKDVNDPTSFKPPEGASKPPGAAITGPKPTPQNQFSEHDKTLYRIPEPQKPQPKPPEDIV
RSNHYDPEEDEEYYRKQLSYFDRRSFDKPPAHIPASHLSEPTKPVHSQNQPSFSSYSAKG
KPEADAGDRSFGEKRYDPVQATPPPPPLPSQHPQPAQPVSSSSVHTHSRGVHGEGNSASL
DFQNSLVSKPDPPPSQSKPAIFRPPNREDTAQTTFYPQKSFPDKAPVNGAEQTQKTVTPA
YNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHNKPDLSSKAPASPKTLMKTHSSAQ
PPEFDSGVETFSIHADKPKYQVNNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNS
NGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGP
HGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Download sequence
Identical sequences G5B6I5
HGL_H00000281537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]