SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000281631-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000281631-2
Domain Number 1 Region: 499-619
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.91e-22
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000281631-2
Sequence length 702
Comment PARP8 (Homo_sapiens) poly (ADP-ribose) polymerase family, member 8
Sequence
MAPARITSSELGEESRQNSTVEEDSEGDNDSEEFYYGGQVSYDGELHKHPQLEADLSAVR
EIYGPHAVSLREYGAIDDVDIDLHIDVSFLDEEIAVAWEVIRTEPIIVRLHCSLTQYLNG
PVPTVDVFQISTKERFGLGHQLKKIMQTFVTQQWKQSKEKSNCLHSKKLSEKKVKSPLHL
FSTLRRSPSYPPPGCGKSKSKLKSEQDGISKTHKLLRRTCSSTVKPEDVCSAKSHRTFGR
SLSSDPRAEQAMTIKSHKLLNRPCPAAVKQEDCLTLKSHKLLTRSCSGDPRCEHTASLKP
HKLLSRSYSSNLRMEELYGLKNHKLLSKSYSSAPKASKTELFKEPTVEGRRLSLTSGLIG
ILTPSSSSSSQPAVPSSSSSQPAPNGAKCIPIRDRGFLVQTIEFAEQRIPVLNEYCVVCD
EPHVFQNGPMLRPTVCERELCVFAFQTLGVMNEAADEIATGAQVVDLLVSMCRSALESPR
KVVIFEPYPSVVDPNDPQMLAFNPRKKNYDRVMKALDSITSIREMTQQLKFMHTPHQFLL
LSSPPAKESNFRAAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIY
LSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSSASQPSLHPVAREAVRDRDHVVHRLPW
DQGQGQSASYEDGQVGDANINTQEGGIHKEILRVIGNQTATG
Download sequence
Identical sequences G5C264
HGL_H00000281631-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]