SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000281722 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000281722
Domain Number 1 Region: 57-224
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.72e-29
Family Canonical RBD 0.0052
Further Details:      
 
Domain Number 2 Region: 229-322
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.09e-19
Family Canonical RBD 0.00011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000281722
Domain Number - Region: 390-466
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00343
Family Double-stranded RNA-binding domain (dsRBD) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000281722
Sequence length 528
Comment RBM46 (Homo_sapiens) RNA binding motif protein 46
Sequence
MNEENMDGANGCSKVRTGIQNEAALLALMEKTGYNMVQENGQRKFGGPPPDWEGPPPPRG
CEVFVGKIPRDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYAFVMYTMKEEAQLAIRI
LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVDVIVYPSATDK
TKNRGFAFVKYESHREPAMARRKLIPGTFQLWGHTIQVDWADPEKEVDEETMQRVKVLFV
RNLMISTTEETIKGEFNKFKPGAVERVKKLRDYAFVHFFNREDAVAAMSVMSGKCIDGAS
IEVTLAKPVNKESTGRQHLNGQISPSPENLIVYINKEENHPKTLGKAPALPARLNGHSPS
PPEVERCTYPFFPGTKLTPISMYSLKSSHFNSAVMHLDYYCNKNNWAPPEYYLYSTTSQD
GKVLLVYKIVIPAIANGSQSYFMPDKLCTTIEDAKELAAQFTLLHLDCSFRRSSINSLSP
VSATLSSGIPSVLPYTSRPYSYPGYPLSLVHGSHVGQRLFISNQASFF
Download sequence
Identical sequences G5C5K3
HGL_H00000281722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]