SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000283243 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000283243
Domain Number 1 Region: 304-434
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-32
Family C-type lectin domain 0.00088
Further Details:      
 
Domain Number 2 Region: 1047-1166
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-29
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 3 Region: 158-291
Classification Level Classification E-value
Superfamily C-type lectin-like 5.7e-29
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1172-1311
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 5 Region: 884-1030
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-28
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 6 Region: 589-730
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-27
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 7 Region: 738-869
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-26
Family C-type lectin domain 0.00097
Further Details:      
 
Domain Number 8 Region: 94-151
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-21
Family Fibronectin type II module 0.0011
Further Details:      
 
Domain Number 9 Region: 439-575
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-20
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 10 Region: 1-92
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000122
Family Cysteine rich domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000283243
Sequence length 1393
Comment PLA2R1 (Homo_sapiens) phospholipase A2 receptor 1, 180kDa
Sequence
MLWKWVSYRHLFNLGANGCLGLNLSNTEQPLGIYECDSTDVSLRWHCNRKMIVGPLQYMV
QVEHDNTVMASWKHLHKWVSYTSGGGDICEHLHKDVYTIKGNDHGTPCVFPFQYKHQWHH
ECIREGRGDNLLWCATTSRYERDEKWGLCPDPTSTKVACDTVWKKDLNSHICYQFNLLSF
LSWNEAHSSCQMQGGDLLSIEDENEENFIKKHMSHEAVEVWIGLNQLDPHAGWQWSDGAP
LSYLNLYPEIHFDPFVEYHCGTFHSFMPTAWRSRDCESTFPYVCKKYLNHTDHETVEKNA
WKYHATHCDPGWNPYNHNCYKLQKEEKTWNEALHSCQSGNSTLIDIASLAEVEFLVNFLG
AENASETWIGLSSNTIPVSFEWSNGSSIIFTNWDIHEPQIFPSRSQLCVSAEHPEGHWKV
KNCEETLFYTCKKAGHIPSDTESGCQEGWERHSEFCYKIDPVLRSFDHASSGYYCPPALI
TITNRFEQAFITNLISSVVKMKDSYFWIALQDQNDTGEYTWKAAGQESELVQYTHWNAYQ
PRYSGGCVAMRGSSPLGRWEVKDCKHFKAMSLCKQSVENREKTEHEERWPFQPCYLDWES
KPGLASCFKIFHSEKVLTKRTWREAEAFCEEFGAHLASFAHIEEENFVNELLHSKFNRTE
ERQFWIGFNKRSPLSSGSWEWSDGTPVVSSFLDNTYFGEEARNCAVFKANRILLPSHCGF
KREWICKIPRDVRPKIPSWYQYDAPWLFYQEAEYLFHTHNSEWASFEFVCGWLRGELLTI
HSAHEQEFILSKIRVLSKYGANWWIGFQEEKANNEFHWSDGSPLIYQNWDKERELSVNNE
SQRCGFISSTTGLWGSEECSVFMPGICKRKKIWVIEAEKNTPKQHGTCPKGWLYFNYKCL
LVIVPKDPSNLKNWTGALDFCITEGGTLVAIESEVEQAFITMNLFGQITNVWIGLQNDDY
EKWLNGKPVAYSNWSPFDIMNIPNHNTTEVQKHTPLCALLSSNPNFHFTGKWYFEDCGKE
GYGFVCEKMQDTSGHRVNASDMYPIPNTLEYGNRTYKIINANMTWYAAIKACLMHGAELV
SIADQYHQSFLTIVLNRLGRARWIGLFTTNNGRNFDWSDGTKSSFTFWKDEEPSFFGDCV
FADMNGRWHSAACESFLQGAICHVPTERKLFEHPVLCSETSIPWIKFKSNCYSFSTVLDS
TSFEAAHEFCKKEGSNLLTIKDEAENSFLLEELLAFGSSVQMVWLNAQIDSKNETIKWFD
GTPTDQSNWGIWKTDMDPLKSHQCIALRIPEGVWQLSPCQDKKGFICKMEADIHTEKELP
GKEPSHSIAPLAIALTLLIILVICTLSFYIYKWNSNFFRRLAGFGNPYYPTTNFSTVHLE
ENILISDLEKNDQ
Download sequence
Identical sequences G5C004
HGL_H00000283243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]