SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000283256 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000283256
Domain Number 1 Region: 1546-1795
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-38
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 2 Region: 1214-1369,1408-1487
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.43e-36
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 3 Region: 766-913,947-994
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.34e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 135-279,369-438
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-29
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000283256
Domain Number - Region: 1802-1841
Classification Level Classification E-value
Superfamily EF-hand 0.0204
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000283256
Sequence length 2020
Comment SCN2A (Homo_sapiens) sodium channel, voltage-gated, type II, alpha subunit
Sequence
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRK
LAIKILVHSYPFSNTLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKI
LARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGL
KTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITS
FFNNSLDGNGTAFNRTVSMFNWDDYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICV
KAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSF
YLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDF
SGAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKDDVVRKSESEDSIRR
KGFRFSLEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFA
DDEHSTFEDNDSRRDSLFVPHRQGERRGTTATPPTRAPRVLPILPVNGKMHSAVDCNGVV
SLVGGPSALTSPAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSMASILTN
TMEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNT
LFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSL
SLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVF
IFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEV
AGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKG
IDFVKRKIREFIQRAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNG
TTSGIGSSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKE
KLNATSSSEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKL
WWNVRKTCYKIVEHNWFETFIVFMILVSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIF
ILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRP
LRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGE
MFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVD
SRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKIILLLFVYFGG
QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNM
VTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILS
IVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGL
LLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILN
SGPPDCDPEKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEE
SAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLP
MVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQE
EVSAIVIQRAYRRYLLKQKVKKVSSIYKKDKGKEGEGTPIKEDILIDKLNENSTPEKTDV
TPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK
Download sequence
Identical sequences HGL_H00000283256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]