SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000283415 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000283415
Domain Number 1 Region: 408-671
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 3.01e-19
Family Glycerol-3-phosphate (1)-acyltransferase 0.032
Further Details:      
 
Domain Number 2 Region: 56-93
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.000000000000327
Family Ribosomal protein L36 0.0014
Further Details:      
 
Domain Number 3 Region: 688-783
Classification Level Classification E-value
Superfamily EF-hand 0.0000011
Family Calmodulin-like 0.028
Further Details:      
 
Weak hits

Sequence:  HGL_H00000283415
Domain Number - Region: 837-879
Classification Level Classification E-value
Superfamily EF-hand 0.0786
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000283415
Sequence length 987
Comment LPCAT1 (Homo_sapiens) lysophosphatidylcholine acyltransferase 1
Sequence
MGAAELASWSQVGGTAPQSPTLWKWPRAGQAQRRAGLMAQRAGIGLRPPPPPALGFKSKA
VLRKRCRDCYLVKRNGRWYVLCKTNPKHKQRQMGTIPGPAPTIGLVSVVLAPVPGKVCHL
TALGTCSEEAPLSGKRVLVSTTPFLRSFLPSGSGGPEAGAGAEVPSVHRVRGSSLRSLAC
SLVRCSGVGDQSWASGGAVSPEPWDCAPVEDFREERARTARCLVPPWTPELSVSVAGALE
ARPGPGAEGLAHSDPWKDGRLPASSTGSSALLRASSPGDAVVAPGEWASQRAELQYPPGP
RGSPRLLPASLLSLGRAALWVMAAASHSSAAHSLGRGLASCGCPGLAVAPAPVPVPLSQV
GCAGRLGSFRTLTRLGSPGRGAQAQVTTIRSHLEVCHRKVAFMTLTLFPIRLLFAAFMML
LAWPLALMASLGPADKEPEQPPALWRRLVDVLLKAIMRTMWFAGGFHHVAVKGRRALPSE
AAILTLAPHSSYFDAIPVTMTMSSVVMKAESRDIPIWGTLIRYIRPVFVSRSDQDSRRKT
VEEIRSRAQSGGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPNRLDTIT
WTWQGPGALEILWLTLCQFHNRVEIEFLPVYSPSEEERRNPALYASNVRRVMAEALGISV
TDYTFEDCQLALAGGQLRLPADSCLLEFARLVRGLGLRPENLEKDLDTYWESAQMRMRKG
GKVGLGEFAACLQVPVSPVLEDMFALFDEGGCGEVDLRECVLALSAVCRPARTLDTIQLA
FKASEASRRRASWCGRAPCARAWLSPRASLLAPASLSRGPWDSHCGLALPDTMYGSPGDG
GVDEDQLSRILRTALGVAELPVTELFRGIDEEEKGRITFVHSQLHIRAHVDTVSGGPLWD
GRPPCPVCLCMWVPRDAGPAPRPWPAAEFQRFAELYPDFAEEHLHPERQSFHGTTLPPPT
PTPNGFCTDFSPESSDSGTKPRCKKLD
Download sequence
Identical sequences G5BPI5
HGL_H00000283415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]