SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284061 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284061
Domain Number 1 Region: 242-560
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.11e-50
Family Diacylglycerol kinase-like 0.0083
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000147
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 
Domain Number 3 Region: 35-77
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000129
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284061
Sequence length 598
Comment DGKE (Homo_sapiens) diacylglycerol kinase, epsilon 64kDa
Sequence
MCLTDGQSAQDLARWLPQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGA
FCDCCGLRVNEGCLKKADKRFQCKEIMLKSDTRAPDAMPHHWIRGNVPLCSYCVVCKQQC
GTKPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPGYITSINQMRKNKKTD
YEVKTVHDECMKNSLKNEKCDFGEFKNLIIPPGYITSINQMRKNKKTDYEVLASKFGKQW
TPLIILANSRSGTNMGEGLLGEFKILLNPVQVFDVTKTPPVKALQLCTLLPCHSARVLVC
GGDGTVGWVLDAVDEMKIKGQEKYIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLR
NVMEADGIKLDRWKVQVTNKGYYNLRKPKEFTMNNYFSIGPDALMALNFHAHREKAPSLF
SSRILNKAVYLFYGTKDCLVQECKDLNKKVELELDGERVELPNLEGIIVLNIGYWGGGCR
LWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQIQVKLANPFRIGQAHTVRLILKCSMMP
MQVDGEPWAQGPCTVTITHKTHASMLYFSGEQTDDDISSASDQEDVKEAEYSDEDVQT
Download sequence
Identical sequences G5C5J1
HGL_H00000284061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]